(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE288

PENCW_16.PE288       Location/Qualifiers
FT   CDS             join(complement(659356..659961),complement(658807..659292),
FT                   complement(658434..658736))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194425" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948847"
FT                   /orf_name="Pc20g02880"
FT                   /product="Pc20g02880 protein"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85617.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="UniParc:UPI0001831AC7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF49"
FT                   /transl_table=1
FT                   /translation="MSAQSSIAASDWGHSYPSIFQLNLEIPAFFMPYRWWEDEATTVFW
FT                   AFDIQGISRVIQFGLFRDENFPRTSLCARNVDTIDTFLMALSEPHEYQLLGNLSHIQRV
FT                   EEILRRSSISPFQAIPWSWLPPQPSPTLDAREIAAAIEAESHFHFKQVAFEELVRAALG
FT                   YNAIFVDWFLQQHEALYIILRDHLGAYPEDIPLYTEVGKHLRSRSPFAYRALVQCLIAV
FT                   RPGGNRDVTKPTAGFEFIAGPIQALFKEQPGRLIAMLKMLSVLTIRFRRKYVHAPTMDW
FT                   RTPFDTSIPFLDDYLESTSPTDLARSMRGLDEHHFAELTRQSLIAEDAVVGQLKVQWRE
FT                   LSVSVWECCAALPDLIPYLQECAQTLLTTRNYHSFTAIIKGLHTYSILKTRPGNTGTQG
FT                   NVVTLETLFPQEILSLMSPAQNYAAYRQHYQKFPGIPFLIPHIRDHKENGESVLQPVFQ
FT                   YLQSTQ"
     MSAQSSIAAS DWGHSYPSIF QLNLEIPAFF MPYRWWEDEA TTVFWAFDIQ GISRVIQFGL        60
     FRDENFPRTS LCARNVDTID TFLMALSEPH EYQLLGNLSH IQRVEEILRR SSISPFQAIP       120
     WSWLPPQPSP TLDAREIAAA IEAESHFHFK QVAFEELVRA ALGYNAIFVD WFLQQHEALY       180
     IILRDHLGAY PEDIPLYTEV GKHLRSRSPF AYRALVQCLI AVRPGGNRDV TKPTAGFEFI       240
     AGPIQALFKE QPGRLIAMLK MLSVLTIRFR RKYVHAPTMD WRTPFDTSIP FLDDYLESTS       300
     PTDLARSMRG LDEHHFAELT RQSLIAEDAV VGQLKVQWRE LSVSVWECCA ALPDLIPYLQ       360
     ECAQTLLTTR NYHSFTAIIK GLHTYSILKT RPGNTGTQGN VVTLETLFPQ EILSLMSPAQ       420
     NYAAYRQHYQ KFPGIPFLIP HIRDHKENGE SVLQPVFQYL QSTQ                        464
//

If you have problems or comments...

PBIL Back to PBIL home page