(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE289

PENCW_16.PE289       Location/Qualifiers
FT   CDS             join(complement(662126..662252),complement(661767..661906),
FT                   complement(661670..661729))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128984"
FT                   /orf_name="Pc20g02890"
FT                   /product="Putative uncharacterized protein Pc20g02890 "
FT                   /protein_id="CAP85618.1"
FT                   /db_xref="UniParc:UPI0001831AC8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF50"
FT                   /transl_table=1
FT                   /translation="MEGGEQNNLIDPNSILALGRPTFGSPLGILGIRFACSKRHTVVSP
FT                   RRTNGHIIWGMHNNAVVDYFLTVTPGTRNIERNILLPKVPNWSILELGSGSGILCITLH
FT                   FPLL"
     MEGGEQNNLI DPNSILALGR PTFGSPLGIL GIRFACSKRH TVVSPRRTNG HIIWGMHNNA        60
     VVDYFLTVTP GTRNIERNIL LPKVPNWSIL ELGSGSGILC ITLHFPLL                    108
//

If you have problems or comments...

PBIL Back to PBIL home page