(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE29

PENCW_16.PE29        Location/Qualifiers
FT   CDS             join(complement(73073..73225),complement(72590..73009))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977332"
FT                   /orf_name="Pc20g00290"
FT                   /product="Pc20g00290 protein"
FT                   /protein_id="CAP85358.1"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="UniParc:UPI00018319D5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF40"
FT                   /transl_table=1
FT                   /translation="MKVFSSGCTFDYSWDEVSTANWRKYCPWNDKSTHVVGVDTLSRTV
FT                   DPSTGILRTERLITCNQSVPQWVLSLLGGTNTSHVYEISYVDPVAKKVTMCSTNLTWSN
FT                   VLSVRETVIYRQSSLSPATTTEFSQEAKITALCGGWQKIKNKVEEASVDRFRENAKIGR
FT                   EGFETVLEMSRRVFGEQRELEKQRLQS"
     MKVFSSGCTF DYSWDEVSTA NWRKYCPWND KSTHVVGVDT LSRTVDPSTG ILRTERLITC        60
     NQSVPQWVLS LLGGTNTSHV YEISYVDPVA KKVTMCSTNL TWSNVLSVRE TVIYRQSSLS       120
     PATTTEFSQE AKITALCGGW QKIKNKVEEA SVDRFRENAK IGREGFETVL EMSRRVFGEQ       180
     RELEKQRLQS                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page