(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE290

PENCW_16.PE290       Location/Qualifiers
FT   CDS             join(complement(665360..665370),complement(665076..665213),
FT                   complement(664723..665007),complement(664296..664590),
FT                   complement(664188..664241))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231325" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948848"
FT                   /orf_name="Pc20g02900"
FT                   /product="Pc20g02900 protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85619.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="UniParc:UPI0001831AC9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF51"
FT                   /transl_table=1
FT                   /translation="MRGPGKHQKRLSAPSHWLLDKMSGTYAPKASPGPHKLRDCLPLIV
FT                   FIRNRLKYALNGREVKAIMMQRLVKVDGKVRTDTTYPAGFMDVISLEKTGEHFRLIYDT
FT                   KGRFTVHRIQAEEAEYKLCKVKRVQLGKGGIPFLVTHDARTIRYPDPAIKVNDTVKVDI
FT                   ATGKILDFVKFDSGVVIMATGGRNMGRVGVITHRERHDGGFNIVHVRDALDNQFATRES
FT                   NVFVIGQDKPWVSLPKGKGVKLSIAEERDRRRAHDLAN"
     MRGPGKHQKR LSAPSHWLLD KMSGTYAPKA SPGPHKLRDC LPLIVFIRNR LKYALNGREV        60
     KAIMMQRLVK VDGKVRTDTT YPAGFMDVIS LEKTGEHFRL IYDTKGRFTV HRIQAEEAEY       120
     KLCKVKRVQL GKGGIPFLVT HDARTIRYPD PAIKVNDTVK VDIATGKILD FVKFDSGVVI       180
     MATGGRNMGR VGVITHRERH DGGFNIVHVR DALDNQFATR ESNVFVIGQD KPWVSLPKGK       240
     GVKLSIAEER DRRRAHDLAN                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page