(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE291

PENCW_16.PE291       Location/Qualifiers
FT   CDS             join(complement(666855..666885),complement(666539..666796),
FT                   complement(665672..666477))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000013358" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977848"
FT                   /orf_name="Pc20g02910"
FT                   /product="Pc20g02910 protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="aspartate-semialdehyde dehydrogenase activity "
FT                   /function="protein dimerization activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85620.1"
FT                   /db_xref="GO:0004073"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831ACA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF52"
FT                   /transl_table=1
FT                   /translation="MAPSFPKKKCGVLGATGSVGQRFILLLADHPFLELHAVGASERSA
FT                   NKKYKDAVNWKQSKPMSEKLSNLVMRDCKPEQFSDCDLVFSGLNSDVAGETEMAFIKAE
FT                   IPVFSNAKNFRKDPMVPLVVPTVNPQHLDLIPHQREQYGLKKGFLVCNSNCAVIGIVIP
FT                   FAALQAKFGPVEEVEVFTEQAVSGAGYPGVPTMDILDNVIPYISGEEDKLENEAQKILG
FT                   SLNASATGFDEQTGLRIGATCTRVGVTDGHMAFVSLRFKNRQTPTAEQVKEALREYKSE
FT                   AQKLGAPSAPEPAIKVFDAPDRPQPRLDRDISGGYTVSVGRVREGAPGGHFDIRFAALS
FT                   HNTVIGAAGSSILNAEVAVIKGYI"
     MAPSFPKKKC GVLGATGSVG QRFILLLADH PFLELHAVGA SERSANKKYK DAVNWKQSKP        60
     MSEKLSNLVM RDCKPEQFSD CDLVFSGLNS DVAGETEMAF IKAEIPVFSN AKNFRKDPMV       120
     PLVVPTVNPQ HLDLIPHQRE QYGLKKGFLV CNSNCAVIGI VIPFAALQAK FGPVEEVEVF       180
     TEQAVSGAGY PGVPTMDILD NVIPYISGEE DKLENEAQKI LGSLNASATG FDEQTGLRIG       240
     ATCTRVGVTD GHMAFVSLRF KNRQTPTAEQ VKEALREYKS EAQKLGAPSA PEPAIKVFDA       300
     PDRPQPRLDR DISGGYTVSV GRVREGAPGG HFDIRFAALS HNTVIGAAGS SILNAEVAVI       360
     KGYI                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page