(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE296

PENCW_16.PE296       Location/Qualifiers
FT   CDS             join(complement(684656..684890),complement(679747..684605))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194392" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948850"
FT                   /orf_name="Pc20g02960"
FT                   /product="Pc20g02960 protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA replication"
FT                   /protein_id="CAP85625.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="UniParc:UPI0001831B9B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF56"
FT                   /transl_table=1
FT                   /translation="MEPFRVRLNCIDHYQATASELDPPLLFRDEVSEKDFKPKVPVIRI
FT                   FGATETGQRVCVHVHGAFPYLYIEYNGSLAPEDVNSAIRTLHLSIDHALAVSFRRNAYD
FT                   RRTAFVAHITLVKGVPFYGYHVGWRFFFKIYLLNPFHMTRLVDLLHQGAVMKRPLQPYE
FT                   AHVQYIPQWMCDYNLYGCAIMSCSQAKFRAPVPEYFELSNLAHRWHDRSILPESILDHP
FT                   ALQKQSHCALEVDVCVQDILNRLDVKERPLHHDFTELLKPVAVNERLVPSVAGLWQDET
FT                   RRRKKRMGLTDPGSTPFGPEELVSMSADPRDQSKGGWIHEEEFREMASQLAANEKQADG
FT                   GKDTSFGTFLDTDDQAKYVKTALDSTEDFFPGKISTSTFDSSRSQEPAEQKLSEISVDE
FT                   GLALSSQTDGQYYSDSDQGGHSLEGIIEHEPETKQDPLGDSFYDEIFDEMPFLDVAAPA
FT                   ESAETNCPEAAMDGGYKEGDYVAQERRPRDQSQNKSVAPKRQRSETLDCHHSPTKRARH
FT                   IAEHGLSDGPLESPNTRKHQQDDKPKNVSFDSNLDSHAETPSSESKSSSQRTVRPKAHS
FT                   YTSGLKFPVVKDPNDPLTILRYSQDEATSSRKDPESSQPLLNSFPSGSATELSGKTSET
FT                   QSSSELHSSATVMGPVSLDPHLSQTVKSIRQSFSFAPNTSLHCFKFASPTFSEVSSSIN
FT                   EHGRPSVVYQKAFYSDEADVPERPREYGGREFRLESNTIHYLPDFDPTAEAPAMFGEQT
FT                   PTAHDRDQQEKVDQQLREWCTSKVWEFAPVPPSRSEVIRWFEELEASQEPDRKAAQPIP
FT                   PEMKSNLLSQIEGPTQKNAHGFKYSQNGVSTSVEHQAQHMSTMSLEVHVNTRGTLMPNP
FT                   EEDEITSLFWCIQSEDEDIEVNSHLPGVHVGMVYHGEGERPEAKISKALTIDVEHEPTE
FT                   LDLINRLIDIVRYYDPDIITGYEVHNASWGYVIERARKKYDFDICEELSRTKSQSNGRF
FT                   GKEADQWGFNHSSSIRITGRHMFNIWRAMKSELNLLQYTMENVVFHVLHRRIPHYSPKH
FT                   LTQWHQSGRPRNILKVVQYFTSRVQMNLEILEANELTPRTSEQARLLGIDFASVITRGS
FT                   QFKVESLMFRIAKPENFLLVSPSRKQVGQQNALECLPLVMEPQSDFYTSPLLVLDFQSL
FT                   YPSVMIAYNYCYSTFLGRAMHWRGRDKMGFIDYKRQPRILELLKDKINIAPNGMMYAKQ
FT                   EARQSLLAKMLSEILETRVMVKNGMKADKDDKVLQRLLNNRQLALKLIANVTYGYTSAS
FT                   FSGRMPCSEIADSIVQTGRETLEKAIAFIHSVERWGAEVVYGDTDSLFVYLKGRTRDQA
FT                   FDIGEEIAQAVTDLNPRPVKLKFEKVYHPCVLLAKKRYVGFKYEHRNQKEPEFDAKGIE
FT                   TVRRDGTPAEQKIEEKALKTLFRTADLSQVKSYFQRQCAKIMQGRISIQDFCFAREVRL
FT                   GTYSDRHLPAGAVISTKRMLEDPRSEPQTGERVPYVVVTGAPGARLVDRCVAPQTLLHD
FT                   AQLELDAEYYITKNIIPPLERIFNLVGANVRQWYDEMPKVQRIRRVEGSALARPNSVGG
FT                   ASRKTLESYMRSSSCVVCRSRLSDAAVPVCGDCLQKPHLTLLDVVSRLQRAEKRVVDLE
FT                   AICRSCMGVSPGDEVSCDSLDCPIFYSRARDAANWRHSKAVLEPVVELLERKGDEGLDW
FT                   "
     MEPFRVRLNC IDHYQATASE LDPPLLFRDE VSEKDFKPKV PVIRIFGATE TGQRVCVHVH        60
     GAFPYLYIEY NGSLAPEDVN SAIRTLHLSI DHALAVSFRR NAYDRRTAFV AHITLVKGVP       120
     FYGYHVGWRF FFKIYLLNPF HMTRLVDLLH QGAVMKRPLQ PYEAHVQYIP QWMCDYNLYG       180
     CAIMSCSQAK FRAPVPEYFE LSNLAHRWHD RSILPESILD HPALQKQSHC ALEVDVCVQD       240
     ILNRLDVKER PLHHDFTELL KPVAVNERLV PSVAGLWQDE TRRRKKRMGL TDPGSTPFGP       300
     EELVSMSADP RDQSKGGWIH EEEFREMASQ LAANEKQADG GKDTSFGTFL DTDDQAKYVK       360
     TALDSTEDFF PGKISTSTFD SSRSQEPAEQ KLSEISVDEG LALSSQTDGQ YYSDSDQGGH       420
     SLEGIIEHEP ETKQDPLGDS FYDEIFDEMP FLDVAAPAES AETNCPEAAM DGGYKEGDYV       480
     AQERRPRDQS QNKSVAPKRQ RSETLDCHHS PTKRARHIAE HGLSDGPLES PNTRKHQQDD       540
     KPKNVSFDSN LDSHAETPSS ESKSSSQRTV RPKAHSYTSG LKFPVVKDPN DPLTILRYSQ       600
     DEATSSRKDP ESSQPLLNSF PSGSATELSG KTSETQSSSE LHSSATVMGP VSLDPHLSQT       660
     VKSIRQSFSF APNTSLHCFK FASPTFSEVS SSINEHGRPS VVYQKAFYSD EADVPERPRE       720
     YGGREFRLES NTIHYLPDFD PTAEAPAMFG EQTPTAHDRD QQEKVDQQLR EWCTSKVWEF       780
     APVPPSRSEV IRWFEELEAS QEPDRKAAQP IPPEMKSNLL SQIEGPTQKN AHGFKYSQNG       840
     VSTSVEHQAQ HMSTMSLEVH VNTRGTLMPN PEEDEITSLF WCIQSEDEDI EVNSHLPGVH       900
     VGMVYHGEGE RPEAKISKAL TIDVEHEPTE LDLINRLIDI VRYYDPDIIT GYEVHNASWG       960
     YVIERARKKY DFDICEELSR TKSQSNGRFG KEADQWGFNH SSSIRITGRH MFNIWRAMKS      1020
     ELNLLQYTME NVVFHVLHRR IPHYSPKHLT QWHQSGRPRN ILKVVQYFTS RVQMNLEILE      1080
     ANELTPRTSE QARLLGIDFA SVITRGSQFK VESLMFRIAK PENFLLVSPS RKQVGQQNAL      1140
     ECLPLVMEPQ SDFYTSPLLV LDFQSLYPSV MIAYNYCYST FLGRAMHWRG RDKMGFIDYK      1200
     RQPRILELLK DKINIAPNGM MYAKQEARQS LLAKMLSEIL ETRVMVKNGM KADKDDKVLQ      1260
     RLLNNRQLAL KLIANVTYGY TSASFSGRMP CSEIADSIVQ TGRETLEKAI AFIHSVERWG      1320
     AEVVYGDTDS LFVYLKGRTR DQAFDIGEEI AQAVTDLNPR PVKLKFEKVY HPCVLLAKKR      1380
     YVGFKYEHRN QKEPEFDAKG IETVRRDGTP AEQKIEEKAL KTLFRTADLS QVKSYFQRQC      1440
     AKIMQGRISI QDFCFAREVR LGTYSDRHLP AGAVISTKRM LEDPRSEPQT GERVPYVVVT      1500
     GAPGARLVDR CVAPQTLLHD AQLELDAEYY ITKNIIPPLE RIFNLVGANV RQWYDEMPKV      1560
     QRIRRVEGSA LARPNSVGGA SRKTLESYMR SSSCVVCRSR LSDAAVPVCG DCLQKPHLTL      1620
     LDVVSRLQRA EKRVVDLEAI CRSCMGVSPG DEVSCDSLDC PIFYSRARDA ANWRHSKAVL      1680
     EPVVELLERK GDEGLDW                                                     1697
//

If you have problems or comments...

PBIL Back to PBIL home page