(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE297

PENCW_16.PE297       Location/Qualifiers
FT   CDS             685215..686627
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194391" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948851"
FT                   /orf_name="Pc20g02970"
FT                   /product="Pc20g02970 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85626.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR021715"
FT                   /db_xref="UniParc:UPI0001831B9C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF57"
FT                   /transl_table=1
FT                   /translation="MSRKPADVASKTPNEYIPSFISKKPFYVDDETNNDYLEHQRLQKA
FT                   TPDQSKWYDRGKRAGPAATKYRKGACENCGAMTHKTKECLSRPRKQGARWTGKDIQADE
FT                   LIQKVDMGWDAKRDRWNGYDATEYRQVVEEYEEMEAIKRMAKENSDLKKLQAGEDGDEG
FT                   PDSDIRYAEESDMGRQQSTATRNLRIREDTAKYLLNLDLDSAKYDPKTRRMVDMGAQDD
FT                   QAAALVAEENFVRASGDAAEFEKAQKYAWESQEKGLPQIHIQANPTSGEVLRKKEMVDS
FT                   EAKREAHRKALLDKYGGVEYTKPNALRETMVVENERFIEYDESGAIKGAPKNATKSKYP
FT                   EDVMVNNHSSVFGSWWYQFKWGYACCYSTVKNSYCTGEDGKKAFEEEGNMLMMTGAADD
FT                   NDEISDNAGNANLSHESEQADDRGQEQDSNTNGKKRTLEELKSGVTEEEYESYKRSRLA
FT                   AEDPMANFIGKD"
     MSRKPADVAS KTPNEYIPSF ISKKPFYVDD ETNNDYLEHQ RLQKATPDQS KWYDRGKRAG        60
     PAATKYRKGA CENCGAMTHK TKECLSRPRK QGARWTGKDI QADELIQKVD MGWDAKRDRW       120
     NGYDATEYRQ VVEEYEEMEA IKRMAKENSD LKKLQAGEDG DEGPDSDIRY AEESDMGRQQ       180
     STATRNLRIR EDTAKYLLNL DLDSAKYDPK TRRMVDMGAQ DDQAAALVAE ENFVRASGDA       240
     AEFEKAQKYA WESQEKGLPQ IHIQANPTSG EVLRKKEMVD SEAKREAHRK ALLDKYGGVE       300
     YTKPNALRET MVVENERFIE YDESGAIKGA PKNATKSKYP EDVMVNNHSS VFGSWWYQFK       360
     WGYACCYSTV KNSYCTGEDG KKAFEEEGNM LMMTGAADDN DEISDNAGNA NLSHESEQAD       420
     DRGQEQDSNT NGKKRTLEEL KSGVTEEEYE SYKRSRLAAE DPMANFIGKD                  470
//

If you have problems or comments...

PBIL Back to PBIL home page