(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE298

PENCW_16.PE298       Location/Qualifiers
FT   CDS             join(687130..687133,687208..687270,687421..687492,
FT                   687603..687742)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128986"
FT                   /orf_name="Pc20g02980"
FT                   /product="Pc20g02980 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85627.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniParc:UPI0001831B9D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF58"
FT                   /transl_table=1
FT                   /translation="MTKGTSSFGKRHNKTHTLCRRCGKRSFHIQKSTCANCGYPAAKTR
FT                   KFNWGEKAKRRKTTGSGRMRSLRDVHRRFQNGFQTGTPKGARGPVTN"
     MTKGTSSFGK RHNKTHTLCR RCGKRSFHIQ KSTCANCGYP AAKTRKFNWG EKAKRRKTTG        60
     SGRMRSLRDV HRRFQNGFQT GTPKGARGPV TN                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page