(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE299

PENCW_16.PE299       Location/Qualifiers
FT   CDS             join(complement(689228..689488),complement(688638..689108),
FT                   complement(688260..688571))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194367" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948852"
FT                   /orf_name="Pc20g02990"
FT                   /product="Pc20g02990 protein"
FT                   /protein_id="CAP85628.1"
FT                   /db_xref="UniParc:UPI0001831B9E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF59"
FT                   /transl_table=1
FT                   /translation="MPSQPPLPPLLAPYVSNLPDSSLTLVSSILGATSNWLILRFLHAA
FT                   LSSPSPNAAFGSDELHNGTKKKVVLVSFMRSYEFWRTEAKRLGLDLARLAEKQQFAFID
FT                   GLSELFYAPQPTATSPSISPAGLGSSPRTTLPMRSPPGAVPGRSPQPAGPTATGARGNA
FT                   TSKQAEPGIAKKLHFSGRGLASLDALEKDISSVIEQQKSSMEDGDELLLIIDQPDLLLA
FT                   ATGPSMGIGATEMSEWITALQQHAHATVLTLATDAPLIHNASTSGGLATPIETEHAALV
FT                   IGLAHRARSVMQLRTLDTGAAKDVSGVLRISRGGGLNASEESLEEREALYFIQRDGGVK
FT                   VFGRGES"
     MPSQPPLPPL LAPYVSNLPD SSLTLVSSIL GATSNWLILR FLHAALSSPS PNAAFGSDEL        60
     HNGTKKKVVL VSFMRSYEFW RTEAKRLGLD LARLAEKQQF AFIDGLSELF YAPQPTATSP       120
     SISPAGLGSS PRTTLPMRSP PGAVPGRSPQ PAGPTATGAR GNATSKQAEP GIAKKLHFSG       180
     RGLASLDALE KDISSVIEQQ KSSMEDGDEL LLIIDQPDLL LAATGPSMGI GATEMSEWIT       240
     ALQQHAHATV LTLATDAPLI HNASTSGGLA TPIETEHAAL VIGLAHRARS VMQLRTLDTG       300
     AAKDVSGVLR ISRGGGLNAS EESLEEREAL YFIQRDGGVK VFGRGES                     347
//

If you have problems or comments...

PBIL Back to PBIL home page