(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE30

PENCW_16.PE30        Location/Qualifiers
FT   CDS             join(73759..74041,74151..74500)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000022344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977333"
FT                   /orf_name="Pc20g00300"
FT                   /product="Pc20g00300 protein"
FT                   /function="antioxidant activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAP85359.1"
FT                   /db_xref="GO:0016209"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI00018319D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF41"
FT                   /transl_table=1
FT                   /translation="MVELRKRKAPAPLLVAEKKTKQAPKPKQDADATDNDTEKRPAQKV
FT                   PEVDDIIDIETFSGEFETNEGEKTTLKKLLEESKSGVVFFTYPKASTPGCTKQACLFRD
FT                   NYTHLTSTGLSIYGLSGDSPKANTTFKTRQNLPYPLMCDPKATLIAAIGFKKSPKGTTR
FT                   GIFAVDKKGKVLLRAAGGPDATVDAVQKIVANAPSVEDSKEEGDETA"
     MVELRKRKAP APLLVAEKKT KQAPKPKQDA DATDNDTEKR PAQKVPEVDD IIDIETFSGE        60
     FETNEGEKTT LKKLLEESKS GVVFFTYPKA STPGCTKQAC LFRDNYTHLT STGLSIYGLS       120
     GDSPKANTTF KTRQNLPYPL MCDPKATLIA AIGFKKSPKG TTRGIFAVDK KGKVLLRAAG       180
     GPDATVDAVQ KIVANAPSVE DSKEEGDETA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page