(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE300

PENCW_16.PE300       Location/Qualifiers
FT   CDS             join(690393..690425,690498..690527,690589..690683,
FT                   690742..691052,691119..691798,691853..692373,6
FT                   92455..692878)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194356" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948853"
FT                   /orf_name="Pc20g03000"
FT                   /product="Pc20g03000 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85629.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR005600"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831B9F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF60"
FT                   /transl_table=1
FT                   /translation="MASTRDSHSFACDECRLRKSRCSKERPVCLQCRQLNKECIYSPKV
FT                   SRSPLTRQHLTYVEDRLHSFETALGRLFPGGDLDATLRSLLQNPEVARAPSSKSSSRHS
FT                   TPKHEPERAEPAPEALPQQADGFDWAEKEITLGDLTDGMAALSIKPEGAGYFGASSSVV
FT                   PLRALFDHGFDLNIPVRSAKSGGVPLKAQLLESAPSGLIEQAFIDAFFLNYHTSYPFIH
FT                   EPTFRMQFNDPSLRPHGTAWHILLNTILALGAWCIGDDSSDLDITFYQEARGYLQQASV
FT                   FETGNLTLVQGLLLLSNYAQKRNKPNTGWNYLGLAVRMAMSLGLHKEFPGWKISLLQRE
FT                   IRRRLWWGVFIFDSGAAKTFGRPILLPEDSVMDAKQVRNIHEEDLTPTTTTLPAESPGP
FT                   TIYSGLIAQASFHLLTNSVYQRLISSPSLTPEDTLNLQKPIEEWYNGLPSYLKHQQLPL
FT                   SMQPANPDPDSLALVRNRLLWRNWNLTILIYRPILLRWAARRWAPLSGSGTATPDAGSE
FT                   DPFETECRLRCLQNARLTISSISDYMANYMCTRLGAWYMLYFLFQAGLIPIVFLMTDPS
FT                   NPEAASWLQDIETTKSLLTHPSLGTNRFATRCLEVINRLLGPPTHPMPQGIPTEGDQLN
FT                   PQHQQQHEHMLPQLQPNMMPFPGQLFSDPGFGGSLFPVEQQMQMHNAGGMDFSEWVNFP
FT                   PAE"
     MASTRDSHSF ACDECRLRKS RCSKERPVCL QCRQLNKECI YSPKVSRSPL TRQHLTYVED        60
     RLHSFETALG RLFPGGDLDA TLRSLLQNPE VARAPSSKSS SRHSTPKHEP ERAEPAPEAL       120
     PQQADGFDWA EKEITLGDLT DGMAALSIKP EGAGYFGASS SVVPLRALFD HGFDLNIPVR       180
     SAKSGGVPLK AQLLESAPSG LIEQAFIDAF FLNYHTSYPF IHEPTFRMQF NDPSLRPHGT       240
     AWHILLNTIL ALGAWCIGDD SSDLDITFYQ EARGYLQQAS VFETGNLTLV QGLLLLSNYA       300
     QKRNKPNTGW NYLGLAVRMA MSLGLHKEFP GWKISLLQRE IRRRLWWGVF IFDSGAAKTF       360
     GRPILLPEDS VMDAKQVRNI HEEDLTPTTT TLPAESPGPT IYSGLIAQAS FHLLTNSVYQ       420
     RLISSPSLTP EDTLNLQKPI EEWYNGLPSY LKHQQLPLSM QPANPDPDSL ALVRNRLLWR       480
     NWNLTILIYR PILLRWAARR WAPLSGSGTA TPDAGSEDPF ETECRLRCLQ NARLTISSIS       540
     DYMANYMCTR LGAWYMLYFL FQAGLIPIVF LMTDPSNPEA ASWLQDIETT KSLLTHPSLG       600
     TNRFATRCLE VINRLLGPPT HPMPQGIPTE GDQLNPQHQQ QHEHMLPQLQ PNMMPFPGQL       660
     FSDPGFGGSL FPVEQQMQMH NAGGMDFSEW VNFPPAE                                697
//

If you have problems or comments...

PBIL Back to PBIL home page