(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE302

PENCW_16.PE302       Location/Qualifiers
FT   CDS             join(696233..696761,696870..697078)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194345" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948854"
FT                   /orf_name="Pc20g03020"
FT                   /product="Pc20g03020 protein"
FT                   /protein_id="CAP85631.1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI0001831BA1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE5"
FT                   /transl_table=1
FT                   /translation="MSSPLRIGVLLVGTVQLLDLSAVDLLYMTTPEYLQECSLPRPLVD
FT                   LGRPCEIHYIAHNANDTAKTTAQMSLQLTDSLTDSAVSPGKLDIVLIPGPPPKAMPPPE
FT                   EYLDFVRAHFAAGAPILSVCTGAYVIGHAGITKGREVTAPRLLIPEMRRKFPEAKLWDD
FT                   SVRVARDGNLWTSGGITNGHDLVAGYLREHYPAALVNTILVAADIPSRPAAYATPAVSD
FT                   TLYILWQIIRAVPNAVVGWFRGR"
     MSSPLRIGVL LVGTVQLLDL SAVDLLYMTT PEYLQECSLP RPLVDLGRPC EIHYIAHNAN        60
     DTAKTTAQMS LQLTDSLTDS AVSPGKLDIV LIPGPPPKAM PPPEEYLDFV RAHFAAGAPI       120
     LSVCTGAYVI GHAGITKGRE VTAPRLLIPE MRRKFPEAKL WDDSVRVARD GNLWTSGGIT       180
     NGHDLVAGYL REHYPAALVN TILVAADIPS RPAAYATPAV SDTLYILWQI IRAVPNAVVG       240
     WFRGR                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page