(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE303

PENCW_16.PE303       Location/Qualifiers
FT   CDS             join(complement(699619..699690),complement(699442..699567),
FT                   complement(699221..699234),complement(698693..698953),
FT                   complement(698181..698639),complement(698044..698119))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977850"
FT                   /orf_name="Pc20g03030"
FT                   /product="Pc20g03030 protein"
FT                   /protein_id="CAP85632.1"
FT                   /db_xref="InterPro:IPR019400"
FT                   /db_xref="UniParc:UPI0001831BA2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE6"
FT                   /transl_table=1
FT                   /translation="MNALSADEMERFQKLSNSYQPDVQGPLVSTKQSSHSIALDYSNAD
FT                   PTLATKTNVSFGGLSLLCYHNIRRMNAWMKLNPNRYQAFLPMPLNQYCSSRIDPVKTEI
FT                   DEVGLQALIDGVIEGSGFGVEILYLDRSEGGAVTPHQLSSDSPSGATIRLLYRPGHYDI
FT                   LYPVEPLNMAPIVNLQYGMTSDYSPWDPTALGFDVNSSLMAIPNLMQDTSFGMGAPMSP
FT                   MPSVSPTPASPFRMSPQQDMYQSPMPTHAAPIPPIPVSPPPQIAPPSSAPPPMTSLPSR
FT                   SSDGPQIRLNPLVMKPNLSRSLPVTTPFKNSPYNQAHFQNSDFEPIHWEPHERR"
     MNALSADEME RFQKLSNSYQ PDVQGPLVST KQSSHSIALD YSNADPTLAT KTNVSFGGLS        60
     LLCYHNIRRM NAWMKLNPNR YQAFLPMPLN QYCSSRIDPV KTEIDEVGLQ ALIDGVIEGS       120
     GFGVEILYLD RSEGGAVTPH QLSSDSPSGA TIRLLYRPGH YDILYPVEPL NMAPIVNLQY       180
     GMTSDYSPWD PTALGFDVNS SLMAIPNLMQ DTSFGMGAPM SPMPSVSPTP ASPFRMSPQQ       240
     DMYQSPMPTH AAPIPPIPVS PPPQIAPPSS APPPMTSLPS RSSDGPQIRL NPLVMKPNLS       300
     RSLPVTTPFK NSPYNQAHFQ NSDFEPIHWE PHERR                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page