(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE305

PENCW_16.PE305       Location/Qualifiers
FT   CDS             join(complement(704716..704759),complement(704504..704662),
FT                   complement(704386..704446),complement(703128..704324))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948855"
FT                   /orf_name="Pc20g03050"
FT                   /product="Pc20g03050 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85634.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="UniParc:UPI0001831BA3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE7"
FT                   /transl_table=1
FT                   /translation="MSDDDDFMQDSGDEDYDFEYEDADEDESGDIGIENKYYNAKQIKV
FT                   DNPEEAVDEFLGIAPMEQDKSDWGFKGLKQAIKLEFKLGRYSDTVAHYRELLTYVKSAV
FT                   TRNYSEKSINNMLDFIEKGSDNAEAYQCMEEFYSLTLESFQNTNNERLWLKTNIKLARL
FT                   WLERKQYGQLGKKVRELHRACQREDGSDDTSKGTYLLELYALEIQMSSETKNNKRLKAL
FT                   YQRALRVRSAVPHPKIMGIIRECGGKMHMSEENWKEAQSDFFESFRNYDEAGSMQRIQV
FT                   LKYLVLTTMLMKSDINPFDSQETKPYKNDPRISAMTDLVDAFQRDDIHAYEDVLSKHPD
FT                   VLADPFIAENIDEVSRNMRTKAVLKLIAPYTRFSLQFISKHIKVSVPEVLDILSFLILD
FT                   KKLNAKIDQDNGTVVVESASDVERLRAVGEWSSALRNLWQTTLNGEGLRANDPSQGSIF
FT                   QSSLLGDEGMRSTRARKDGRGKMPAKWF"
     MSDDDDFMQD SGDEDYDFEY EDADEDESGD IGIENKYYNA KQIKVDNPEE AVDEFLGIAP        60
     MEQDKSDWGF KGLKQAIKLE FKLGRYSDTV AHYRELLTYV KSAVTRNYSE KSINNMLDFI       120
     EKGSDNAEAY QCMEEFYSLT LESFQNTNNE RLWLKTNIKL ARLWLERKQY GQLGKKVREL       180
     HRACQREDGS DDTSKGTYLL ELYALEIQMS SETKNNKRLK ALYQRALRVR SAVPHPKIMG       240
     IIRECGGKMH MSEENWKEAQ SDFFESFRNY DEAGSMQRIQ VLKYLVLTTM LMKSDINPFD       300
     SQETKPYKND PRISAMTDLV DAFQRDDIHA YEDVLSKHPD VLADPFIAEN IDEVSRNMRT       360
     KAVLKLIAPY TRFSLQFISK HIKVSVPEVL DILSFLILDK KLNAKIDQDN GTVVVESASD       420
     VERLRAVGEW SSALRNLWQT TLNGEGLRAN DPSQGSIFQS SLLGDEGMRS TRARKDGRGK       480
     MPAKWF                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page