(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE306

PENCW_16.PE306       Location/Qualifiers
FT   CDS             join(705768..705817,705874..705920,705990..706091,
FT                   706238..706359,706412..706613,706669..706787)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977851"
FT                   /orf_name="Pc20g03060"
FT                   /product="Pc20g03060 protein"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85635.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI0001831BA4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE8"
FT                   /transl_table=1
FT                   /translation="MQLCGRQKVVQRKMVLLGDGACGKTSALNVFTPSSPRFSKKFYYL
FT                   QKHTSKCRLLTLVIGCTQRAYNIFVDNIHVELSLWDTAGQEEFDRLRALSYEDTHVLML
FT                   CFSVDSPDSFENVSSKWIAEINENCPGVRVVLTALKCDLRKDEDMNENPNTISFDQGLA
FT                   KAKEIGAVKYLECSAVQNRGIRESFYEAAKVALEVNAGGSSSSGSQCIIQ"
     MQLCGRQKVV QRKMVLLGDG ACGKTSALNV FTPSSPRFSK KFYYLQKHTS KCRLLTLVIG        60
     CTQRAYNIFV DNIHVELSLW DTAGQEEFDR LRALSYEDTH VLMLCFSVDS PDSFENVSSK       120
     WIAEINENCP GVRVVLTALK CDLRKDEDMN ENPNTISFDQ GLAKAKEIGA VKYLECSAVQ       180
     NRGIRESFYE AAKVALEVNA GGSSSSGSQC IIQ                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page