(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE308

PENCW_16.PE308       Location/Qualifiers
FT   CDS             join(complement(709763..709879),complement(709087..709698))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671924"
FT                   /orf_name="Pc20g03080"
FT                   /product="Pc20g03080 protein"
FT                   /function="FMN binding"
FT                   /protein_id="CAP85637.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI0001831C7F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF0"
FT                   /transl_table=1
FT                   /translation="MAESLNPPLSYEASATTTHPHVATSLPSEVIACLKNSRFLHLATC
FT                   DDKTPHISLMSYTYLPSTPFDPHPIIIMTTNPASRKTNHLLSNPRVSLLVHDWVSHRPP
FT                   TRAPTQGDREGSPPPAATRSSLASLLLNLNTSALSSISTTITGEAQFLEPGSEEESWCK
FT                   ARHLENNTFEEEEINLFGQQQQQDPSARRPSLSIDTDVRVVTVRVTEGRIADWKGGVRD
FT                   WVLLPAEQQDAGLVNGVASS"
     MAESLNPPLS YEASATTTHP HVATSLPSEV IACLKNSRFL HLATCDDKTP HISLMSYTYL        60
     PSTPFDPHPI IIMTTNPASR KTNHLLSNPR VSLLVHDWVS HRPPTRAPTQ GDREGSPPPA       120
     ATRSSLASLL LNLNTSALSS ISTTITGEAQ FLEPGSEEES WCKARHLENN TFEEEEINLF       180
     GQQQQQDPSA RRPSLSIDTD VRVVTVRVTE GRIADWKGGV RDWVLLPAEQ QDAGLVNGVA       240
     SS                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page