(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE309

PENCW_16.PE309       Location/Qualifiers
FT   CDS             join(complement(710846..710922),complement(710688..710771),
FT                   complement(710503..710606),complement(710322..710407))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948856"
FT                   /orf_name="Pc20g03090"
FT                   /product="Putative uncharacterized protein Pc20g03090 "
FT                   /protein_id="CAP85638.1"
FT                   /db_xref="UniParc:UPI0001831C80"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF1"
FT                   /transl_table=1
FT                   /translation="MRLTNDESEVDNKLGRRIKWEEEEEELKLQGRGRVEEGAMIGVGV
FT                   PIRSESMRITPSQYHVGMSGDAVDFILLNGSCLCAGKELPRVLDVLGTIGLPQATACTW
FT                   NSVLRTSPLIRD"
     MRLTNDESEV DNKLGRRIKW EEEEEELKLQ GRGRVEEGAM IGVGVPIRSE SMRITPSQYH        60
     VGMSGDAVDF ILLNGSCLCA GKELPRVLDV LGTIGLPQAT ACTWNSVLRT SPLIRD           116
//

If you have problems or comments...

PBIL Back to PBIL home page