(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE31

PENCW_16.PE31        Location/Qualifiers
FT   CDS             join(complement(75774..75834),complement(75288..75726),
FT                   complement(74982..75226),complement(74747..74934))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19824085"
FT                   /orf_name="Pc20g00310"
FT                   /product="Pc20g00310 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85360.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI00018319D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF42"
FT                   /transl_table=1
FT                   /translation="MPVTQSIEREASGSKSQFAPGHKIPVQHLKKPGLQSDLGDPKPVS
FT                   THIPTEDYGYQTYKAAGKLEGKKAIITGGDSGIGRAIAILFAMEGASSVIVYLPEEESD
FT                   AQTTKKRVEEHGQQCHTLAIDLRQKENCRKVINTALEKMGGIDILVNNAAFQDMLSDIS
FT                   ELEESQWEKTFNTNIHSFFYLSKYVLPHMKEGSTIINCASVNPYIGRGDLLDYTSTKGA
FT                   IVAFTRGLSNQQIKKGIRVNCVCPGPIWTPLIPATMQTEAMEQFHAVPIGRPGQPSEVA
FT                   TCFVFLASQDSSYISGQCLHPNGGMMVNG"
     MPVTQSIERE ASGSKSQFAP GHKIPVQHLK KPGLQSDLGD PKPVSTHIPT EDYGYQTYKA        60
     AGKLEGKKAI ITGGDSGIGR AIAILFAMEG ASSVIVYLPE EESDAQTTKK RVEEHGQQCH       120
     TLAIDLRQKE NCRKVINTAL EKMGGIDILV NNAAFQDMLS DISELEESQW EKTFNTNIHS       180
     FFYLSKYVLP HMKEGSTIIN CASVNPYIGR GDLLDYTSTK GAIVAFTRGL SNQQIKKGIR       240
     VNCVCPGPIW TPLIPATMQT EAMEQFHAVP IGRPGQPSEV ATCFVFLASQ DSSYISGQCL       300
     HPNGGMMVNG                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page