(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE314

PENCW_16.PE314       Location/Qualifiers
FT   CDS             <718586..719395
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194266" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948859"
FT                   /orf_name="Pc20g03140"
FT                   /product="Pc20g03140 protein"
FT                   /protein_id="CAP85643.1"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="UniParc:UPI0001831C85"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP5"
FT                   /transl_table=1
FT                   /translation="HGYTQSGSLFHAKSRALTKHIQKAFPLHEVTAIYPTAPIRLLPAD
FT                   IPGYEPSSEGGADNEIESYGWWRRSNTANPPLYIGIEEGFATVARTLKQEGPFDGVIGF
FT                   SQGAALAAMVAALLEPGRKASFEQFSKISAEGAAGMTIPAPFGEEGFQHPQLKFAVCYS
FT                   GFRAPGARYRGFYEEPAIQTPVLHVLGSLDAVVEEARSQALVEACAGEPEKDGLVVWHP
FT                   GGHFLPSQRPYLDATVRFIREQMERSDGSNGKGKEVEEDVNDMDLPF"
     HGYTQSGSLF HAKSRALTKH IQKAFPLHEV TAIYPTAPIR LLPADIPGYE PSSEGGADNE        60
     IESYGWWRRS NTANPPLYIG IEEGFATVAR TLKQEGPFDG VIGFSQGAAL AAMVAALLEP       120
     GRKASFEQFS KISAEGAAGM TIPAPFGEEG FQHPQLKFAV CYSGFRAPGA RYRGFYEEPA       180
     IQTPVLHVLG SLDAVVEEAR SQALVEACAG EPEKDGLVVW HPGGHFLPSQ RPYLDATVRF       240
     IREQMERSDG SNGKGKEVEE DVNDMDLPF                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page