(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE315

PENCW_16.PE315       Location/Qualifiers
FT   CDS             join(complement(721280..721363),complement(721168..721224),
FT                   complement(720867..721103),complement(720326..720814),
FT                   complement(719670..720272))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948860"
FT                   /orf_name="Pc20g03150"
FT                   /product="Pc20g03150 protein"
FT                   /protein_id="CAP85644.1"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001831C86"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP6"
FT                   /transl_table=1
FT                   /translation="MSGGLLKPEKDFTKDADKLIPEAEALAKTDVQGAVDKLLGLEKQS
FT                   RQASDLATTSRLLIAIVTISKNSGDWNLLNDQVLLLSKKHAQLKQATTKMVQTVMTFLD
FT                   ETPNLEVKMSVIETLRTVTEGKIFVEVERARVTRILSNIKKTQGDLTSAADILCELQVE
FT                   TFGSMTRREKTEFILEQVSLCIERGDWTQAQILSRKINKRYFSRKPKKSAEQIETLKKE
FT                   AEEREKTRAPDEPPMEVDDDVTDLKLRYFEQQIILANHDNKYLEVCKNYREVLDTEAVE
FT                   NNPEHLRASLARIVYYVVLSPYDNEQSDLLHRIKQDSRLSQIPEESRLLKLFTIPELMR
FT                   WPMVAEQFGPHLCSTDVFDAEAKQSTENQANQRWQDLRKRVIEHNVRVVAKYYTRIQMG
FT                   RLTQLLDLTEEETEKYISDLVTSKTIYAKIDRPARLVNFAKPRDADDVLNEWSSDMKNL
FT                   LGLLERIDHLITKEEMMARIQPTRSDKGKAH"
     MSGGLLKPEK DFTKDADKLI PEAEALAKTD VQGAVDKLLG LEKQSRQASD LATTSRLLIA        60
     IVTISKNSGD WNLLNDQVLL LSKKHAQLKQ ATTKMVQTVM TFLDETPNLE VKMSVIETLR       120
     TVTEGKIFVE VERARVTRIL SNIKKTQGDL TSAADILCEL QVETFGSMTR REKTEFILEQ       180
     VSLCIERGDW TQAQILSRKI NKRYFSRKPK KSAEQIETLK KEAEEREKTR APDEPPMEVD       240
     DDVTDLKLRY FEQQIILANH DNKYLEVCKN YREVLDTEAV ENNPEHLRAS LARIVYYVVL       300
     SPYDNEQSDL LHRIKQDSRL SQIPEESRLL KLFTIPELMR WPMVAEQFGP HLCSTDVFDA       360
     EAKQSTENQA NQRWQDLRKR VIEHNVRVVA KYYTRIQMGR LTQLLDLTEE ETEKYISDLV       420
     TSKTIYAKID RPARLVNFAK PRDADDVLNE WSSDMKNLLG LLERIDHLIT KEEMMARIQP       480
     TRSDKGKAH                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page