(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE316

PENCW_16.PE316       Location/Qualifiers
FT   CDS             join(722482..722806,722860..724223)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948861"
FT                   /orf_name="Pc20g03160"
FT                   /product="Pc20g03160 protein"
FT                   /function="binding"
FT                   /function="uroporphyrin-III C-methyltransferase activity "
FT                   /biological_process="siroheme biosynthetic process "
FT                   /protein_id="CAP85645.1"
FT                   /db_xref="GO:0004851"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0019354"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012066"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831C87"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP7"
FT                   /transl_table=1
FT                   /translation="MKDASCDPKPPVPLMAAWNTESQVHLIVGSNPLAAARCARSLEVG
FT                   ATPIIIAPETDDMHFTLSEHIANGSAQWIRHEFEDKDLTTLGREEVDHIVDLVFVTLGS
FT                   NNSLSPHISKLCRRLRIPVNVSDAPELCSFTLLSTYSDGPLHIGITTSGRGCKLASRLR
FT                   REIASFLPQNLGTAIDRLGAVRRRLWEEDSAAGLIEGIFDREDDDSTGQKHTFNNLVTE
FT                   GDAAAAKTRRVRWLSQICEYWPLRKLVSITDADMDAILKAYTAGNDTTNGTNGLDALSK
FT                   KGKIVLAGSGPGHPDLLTRATYHAIHNADIILADKLVPAPVLDLIPRRTEVHIARKFPG
FT                   NADQAQEEFLVMGLAALKQGRQVLRLKQGDPYLYGRGAEEFEFFRKEGYSPVVLPGITS
FT                   AMSASLFADIPATHRGVSDQVLVCTGTGRKGAAPNPPTYVPTQTVVFLMALHRLSALVE
FT                   SLTTFPAEDTGPQSRTLWPKETPCAIVERASCPDQRVIRSTLEHVCLAFEEAGSRPPGL
FT                   LVVGASCHVLHNPQGQRWVIEEGFHGLDELRSEVDVVAVSMDEKQ"
     MKDASCDPKP PVPLMAAWNT ESQVHLIVGS NPLAAARCAR SLEVGATPII IAPETDDMHF        60
     TLSEHIANGS AQWIRHEFED KDLTTLGREE VDHIVDLVFV TLGSNNSLSP HISKLCRRLR       120
     IPVNVSDAPE LCSFTLLSTY SDGPLHIGIT TSGRGCKLAS RLRREIASFL PQNLGTAIDR       180
     LGAVRRRLWE EDSAAGLIEG IFDREDDDST GQKHTFNNLV TEGDAAAAKT RRVRWLSQIC       240
     EYWPLRKLVS ITDADMDAIL KAYTAGNDTT NGTNGLDALS KKGKIVLAGS GPGHPDLLTR       300
     ATYHAIHNAD IILADKLVPA PVLDLIPRRT EVHIARKFPG NADQAQEEFL VMGLAALKQG       360
     RQVLRLKQGD PYLYGRGAEE FEFFRKEGYS PVVLPGITSA MSASLFADIP ATHRGVSDQV       420
     LVCTGTGRKG AAPNPPTYVP TQTVVFLMAL HRLSALVESL TTFPAEDTGP QSRTLWPKET       480
     PCAIVERASC PDQRVIRSTL EHVCLAFEEA GSRPPGLLVV GASCHVLHNP QGQRWVIEEG       540
     FHGLDELRSE VDVVAVSMDE KQ                                                562
//

If you have problems or comments...

PBIL Back to PBIL home page