(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE317

PENCW_16.PE317       Location/Qualifiers
FT   CDS             join(724533..724588,724619..724727,724847..724931,
FT                   724936..725133,725545..726365)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000241645" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977852"
FT                   /orf_name="Pc20g03170"
FT                   /product="Pc20g03170 protein"
FT                   /function="deoxyribose-phosphate aldolase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /biological_process="deoxyribonucleotide catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85646.1"
FT                   /db_xref="GO:0004139"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009264"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022979"
FT                   /db_xref="UniParc:UPI0001831C88"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP8"
FT                   /transl_table=1
FT                   /translation="MSARPPKPVYFSNGQALQSQTANQRAHSPPLTVRLTRFIESIYFF
FT                   LGLYFTTLFSLDSYAAAENSSFNINNQKNRYTTRSRWGAQPHSVEEAEAEVEVAVVRDL
FT                   VRDALAVWMMSVGRSARAVNKQTVKAVELLLKCNLKEEKSPNGPRCALHQPPSMSEIPA
FT                   TNAEWADKIANMKKQLPRRSLTQPPIPTQIHRTIDHTLLTTPVDASQIDTLCKEALEYD
FT                   FAGVCVRLEHVARAAGHLKGSNTAVACVVGFPEGTHETIEKVREAKEAVQQGATELDMV
FT                   IRYNLLKEGRYKEVFDDVLAVRHAAPTPIVLKAILEATELEEHQLIDATIVSCMAGADY
FT                   IKTSTGWNGGASAQHLKLMNFAAQMCGCTCLIKASGGIRNAEELLRMLKAGANRIGTSS
FT                   GVKIMKEIDEGEVLEQGCGHAVA"
     MSARPPKPVY FSNGQALQSQ TANQRAHSPP LTVRLTRFIE SIYFFLGLYF TTLFSLDSYA        60
     AAENSSFNIN NQKNRYTTRS RWGAQPHSVE EAEAEVEVAV VRDLVRDALA VWMMSVGRSA       120
     RAVNKQTVKA VELLLKCNLK EEKSPNGPRC ALHQPPSMSE IPATNAEWAD KIANMKKQLP       180
     RRSLTQPPIP TQIHRTIDHT LLTTPVDASQ IDTLCKEALE YDFAGVCVRL EHVARAAGHL       240
     KGSNTAVACV VGFPEGTHET IEKVREAKEA VQQGATELDM VIRYNLLKEG RYKEVFDDVL       300
     AVRHAAPTPI VLKAILEATE LEEHQLIDAT IVSCMAGADY IKTSTGWNGG ASAQHLKLMN       360
     FAAQMCGCTC LIKASGGIRN AEELLRMLKA GANRIGTSSG VKIMKEIDEG EVLEQGCGHA       420
     VA                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page