(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE318

PENCW_16.PE318       Location/Qualifiers
FT   CDS             join(complement(728624..728968),complement(727198..728562))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194233" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948862"
FT                   /orf_name="Pc20g03180"
FT                   /product="Pc20g03180 protein"
FT                   /protein_id="CAP85647.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001831C89"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP9"
FT                   /transl_table=1
FT                   /translation="MLSESFVASTLSSAKSPTASLRDVGVCIHELQPSSILRSTFKKSS
FT                   TLTNCLAVSPSHIFTAQADKAVLHVYNREKGNQEGVVPFPERIRSIAVAGGKYGDVLVL
FT                   GTEGGRLIVWETCTGRQVATTASHLQPVTSLVVDPTSNFILSGSADASVHVWSLPGILS
FT                   FSKPALSATRQPTNSPIRTFSNHRAAITSLAVGHSNGRHNIVVSTAKDNTAIAWDYHTG
FT                   RALRTFLLPLSATSVALDPVDRAFYVGYEDGSVQSVDFYRSQSAQHPLHDPSVQSTPAQ
FT                   VSMEDRWLPPSAETGSAKAISLTYDGTTLLSGHANGKVLSWNVARRKYTSSVADYTHPI
FT                   TNLVMLPPGGIPHPSSDLKRKAHTIVKPRHDSGLSAPNHAPGAVPAEYMFHTQIIAPSD
FT                   SRKPTEFSQALTHSSFPTSMIEDGLAELAAFRQPGSAEVTRVASNAVPARETLEDTAAR
FT                   DSQVTELENEVAVLKKKVAVNETARHNADDEVVQLRSDLANLQDYINELHEKQEAAQQE
FT                   KVLRQARKQEHETKKREAWLAAEKKGRNGDAVIQKMDIDGDVTSDSDDPSDE"
     MLSESFVAST LSSAKSPTAS LRDVGVCIHE LQPSSILRST FKKSSTLTNC LAVSPSHIFT        60
     AQADKAVLHV YNREKGNQEG VVPFPERIRS IAVAGGKYGD VLVLGTEGGR LIVWETCTGR       120
     QVATTASHLQ PVTSLVVDPT SNFILSGSAD ASVHVWSLPG ILSFSKPALS ATRQPTNSPI       180
     RTFSNHRAAI TSLAVGHSNG RHNIVVSTAK DNTAIAWDYH TGRALRTFLL PLSATSVALD       240
     PVDRAFYVGY EDGSVQSVDF YRSQSAQHPL HDPSVQSTPA QVSMEDRWLP PSAETGSAKA       300
     ISLTYDGTTL LSGHANGKVL SWNVARRKYT SSVADYTHPI TNLVMLPPGG IPHPSSDLKR       360
     KAHTIVKPRH DSGLSAPNHA PGAVPAEYMF HTQIIAPSDS RKPTEFSQAL THSSFPTSMI       420
     EDGLAELAAF RQPGSAEVTR VASNAVPARE TLEDTAARDS QVTELENEVA VLKKKVAVNE       480
     TARHNADDEV VQLRSDLANL QDYINELHEK QEAAQQEKVL RQARKQEHET KKREAWLAAE       540
     KKGRNGDAVI QKMDIDGDVT SDSDDPSDE                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page