(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE319

PENCW_16.PE319       Location/Qualifiers
FT   CDS             join(730217..731329,731389..732381)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217213" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824634"
FT                   /orf_name="Pc20g03190"
FT                   /product="Pc20g03190 protein"
FT                   /protein_id="CAP85648.1"
FT                   /db_xref="UniParc:UPI0001831C8A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ0"
FT                   /transl_table=1
FT                   /translation="MDSGATDIPSHACFPAQIQTHIRNQGSNSSSMSHDVMAMAEPIPS
FT                   PRRWSPTYVPRRRSRQMPSLSFVPSPVMPRIESHDFSTSASRRTTDRGPACMSPFRSVR
FT                   RMKEPFQLMLPTSPASLEGPPPNFPEKTRRPSKAPADHTLRTWRSDQNLTCGSLEAFGL
FT                   LPSPPISESRPASTGPELSYFDSQSSDESVRSSDGKDEKDEPGTQPEVSTKAATLEIGE
FT                   KIQYTAYRPPDWKNQPRTDVMNVHEAHSEFVRQCESGNAQQSNPQSPKKAAPSQASPKP
FT                   ESSETVLIPGSSPRPQRPRTATVSSEASWVPSNFSYCERWLQGVPVDKVDDQKTSTKEF
FT                   TNRRKFQIVENDPPMPKLDIIPGAKALEEPVRFVVASKTKPKLVDIARQSSPSPPLLPP
FT                   PCLQPNTVPTTPDQRQEEVSAFSPDTPLDMSDSGYGTRDSGYSFDSFEGSKVDDDDDAY
FT                   TDPGSLTSSDSVGSTVICEKPESTQGEREISPQPEIRSGSVSPKASSPPTTHAPGRKSP
FT                   MSEQEDEKPRILHHDWTLDDHEWTLDELDHSVKDFPRHMLRLASPVMVFLRKNDEKALI
FT                   KPFRTIFPDVAENLLDGLCAALLARNYLLSLSTTCRTKPTTSPRKDAYTIDGVPKKAYN
FT                   TLGIQLPPGSASKPKDPLFSSRSADLQTQLERIVDNLLFAICGRSDPTLKSAVEVLAQV
FT                   LETNASH"
     MDSGATDIPS HACFPAQIQT HIRNQGSNSS SMSHDVMAMA EPIPSPRRWS PTYVPRRRSR        60
     QMPSLSFVPS PVMPRIESHD FSTSASRRTT DRGPACMSPF RSVRRMKEPF QLMLPTSPAS       120
     LEGPPPNFPE KTRRPSKAPA DHTLRTWRSD QNLTCGSLEA FGLLPSPPIS ESRPASTGPE       180
     LSYFDSQSSD ESVRSSDGKD EKDEPGTQPE VSTKAATLEI GEKIQYTAYR PPDWKNQPRT       240
     DVMNVHEAHS EFVRQCESGN AQQSNPQSPK KAAPSQASPK PESSETVLIP GSSPRPQRPR       300
     TATVSSEASW VPSNFSYCER WLQGVPVDKV DDQKTSTKEF TNRRKFQIVE NDPPMPKLDI       360
     IPGAKALEEP VRFVVASKTK PKLVDIARQS SPSPPLLPPP CLQPNTVPTT PDQRQEEVSA       420
     FSPDTPLDMS DSGYGTRDSG YSFDSFEGSK VDDDDDAYTD PGSLTSSDSV GSTVICEKPE       480
     STQGEREISP QPEIRSGSVS PKASSPPTTH APGRKSPMSE QEDEKPRILH HDWTLDDHEW       540
     TLDELDHSVK DFPRHMLRLA SPVMVFLRKN DEKALIKPFR TIFPDVAENL LDGLCAALLA       600
     RNYLLSLSTT CRTKPTTSPR KDAYTIDGVP KKAYNTLGIQ LPPGSASKPK DPLFSSRSAD       660
     LQTQLERIVD NLLFAICGRS DPTLKSAVEV LAQVLETNAS H                           701
//

If you have problems or comments...

PBIL Back to PBIL home page