(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE32

PENCW_16.PE32        Location/Qualifiers
FT   CDS             76813..78951
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187542" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946682"
FT                   /orf_name="Pc20g00320"
FT                   /product="Pc20g00320 protein"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAP85361.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="InterPro:IPR007151"
FT                   /db_xref="InterPro:IPR012173"
FT                   /db_xref="UniParc:UPI00018319D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF43"
FT                   /transl_table=1
FT                   /translation="MAKGQSKSKTVSASTAQASEQMPLSFALSSPWSFLRPTNDLHTNV
FT                   VDSAKHILDSLAGSVVDAQTARRQLNKKRKRSDLESDSVTQLQLKNLYVDGFTSNQIWE
FT                   QATRILQSTGDEIERDITLITQHGGYMESADSGQLEDISDPEGAQSDSDSQESMLEDLS
FT                   EGSGAEDDLDEGSDEEVDMGSDDDMEDIEDMDEDNSSVGSAEEEPEVFVEDKFGLNDGF
FT                   FSIDDFNKQSEALERQDAAGGPEQEDSDEEDLDWHSNPLIAGNAATIHDDDKSKNSRPT
FT                   EKEDESMDDSEEEGPTFGNADLNGDSDSDDEDAADMEDGEAAAWVNTSDIKYADFFAPP
FT                   PRKVSNKKHRALPKTQPDAPAIDESDVKRAMDDVRRDLFDDMDADSAEEEDENLDGSTD
FT                   PTAQRSTHEKQRARIADEIRRLEAANVAKKEWMYTGEARAVERPVNSLIEEDLEFERIG
FT                   KPVPVNTNETTEDIEELVKRRILAMEFDEVIRRRPGAEGQQAGRKPRFELDDTKPQQGL
FT                   AEMYETEHLRANDPNFVDTKDRKLMREHAEITSLWNELSSQLDTLCNWHYKPKVAQASI
FT                   NVVTDAPTIMMEEARPTAGGAAGGPVGLAPQEIYAPGDDGRVKGEVVLKTGASISKEEM
FT                   SREQKAKNRRQNKQTQKKADAAKPTQQKPGKAAEKQQMISDLKKGGVKVIDKEGRMTNI
FT                   DGGSVQEGAKNRGDNLKL"
     MAKGQSKSKT VSASTAQASE QMPLSFALSS PWSFLRPTND LHTNVVDSAK HILDSLAGSV        60
     VDAQTARRQL NKKRKRSDLE SDSVTQLQLK NLYVDGFTSN QIWEQATRIL QSTGDEIERD       120
     ITLITQHGGY MESADSGQLE DISDPEGAQS DSDSQESMLE DLSEGSGAED DLDEGSDEEV       180
     DMGSDDDMED IEDMDEDNSS VGSAEEEPEV FVEDKFGLND GFFSIDDFNK QSEALERQDA       240
     AGGPEQEDSD EEDLDWHSNP LIAGNAATIH DDDKSKNSRP TEKEDESMDD SEEEGPTFGN       300
     ADLNGDSDSD DEDAADMEDG EAAAWVNTSD IKYADFFAPP PRKVSNKKHR ALPKTQPDAP       360
     AIDESDVKRA MDDVRRDLFD DMDADSAEEE DENLDGSTDP TAQRSTHEKQ RARIADEIRR       420
     LEAANVAKKE WMYTGEARAV ERPVNSLIEE DLEFERIGKP VPVNTNETTE DIEELVKRRI       480
     LAMEFDEVIR RRPGAEGQQA GRKPRFELDD TKPQQGLAEM YETEHLRAND PNFVDTKDRK       540
     LMREHAEITS LWNELSSQLD TLCNWHYKPK VAQASINVVT DAPTIMMEEA RPTAGGAAGG       600
     PVGLAPQEIY APGDDGRVKG EVVLKTGASI SKEEMSREQK AKNRRQNKQT QKKADAAKPT       660
     QQKPGKAAEK QQMISDLKKG GVKVIDKEGR MTNIDGGSVQ EGAKNRGDNL KL               712
//

If you have problems or comments...

PBIL Back to PBIL home page