(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE321

PENCW_16.PE321       Location/Qualifiers
FT   CDS             join(complement(735831..736652),complement(735516..735773),
FT                   complement(735132..735455))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128988"
FT                   /orf_name="Pc20g03210"
FT                   /product="Pc20g03210 protein"
FT                   /function="phosphoserine phosphatase activity"
FT                   /biological_process="L-serine biosynthetic process "
FT                   /protein_id="CAP85650.1"
FT                   /db_xref="GO:0004647"
FT                   /db_xref="GO:0006564"
FT                   /db_xref="InterPro:IPR004469"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831C8C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ2"
FT                   /transl_table=1
FT                   /translation="MAESTRTTRPSLGQMRSSSFLQDHQQYKPMAPINPISQTIGEVLA
FT                   NQTEDQLVLNSNPIKPDPERVTDSGIIHSIFNHQANPLPTGTSQVVATIYYKSNNPVHP
FT                   HYHPDSGPQNVPGDKIPAPKVPEGSAPTEDMDKFPREPPAPEPEPLDHLYGPYVSQLCL
FT                   TNFLQILETLPTPYQRMNTSHRCLDRDEHPRVVEVTFSPPPNPEYLSFPDLRKHESIWR
FT                   FEREWNVEVVLQKESVFRRHKRLAVFDMDSTLIDNECIDEIAKFIGVEKEVSEITERAM
FT                   NGELDFTASLKERVGLLNGVSADVFEKLKSVLKIAKGARELCRALKALGYKIAVVSGGF
FT                   QPLAEWLAGQLGIDIAIANHLEIDEATQTLTGKLVPSYPIVDAAHKRTLLKSIAAENGI
FT                   PLSQTMAVGDGANDLLMLHAAGLGVAWRAKSKVQLEAPVRINGESLVDVLYLLGMDNED
FT                   IAELTSDVQ"
     MAESTRTTRP SLGQMRSSSF LQDHQQYKPM APINPISQTI GEVLANQTED QLVLNSNPIK        60
     PDPERVTDSG IIHSIFNHQA NPLPTGTSQV VATIYYKSNN PVHPHYHPDS GPQNVPGDKI       120
     PAPKVPEGSA PTEDMDKFPR EPPAPEPEPL DHLYGPYVSQ LCLTNFLQIL ETLPTPYQRM       180
     NTSHRCLDRD EHPRVVEVTF SPPPNPEYLS FPDLRKHESI WRFEREWNVE VVLQKESVFR       240
     RHKRLAVFDM DSTLIDNECI DEIAKFIGVE KEVSEITERA MNGELDFTAS LKERVGLLNG       300
     VSADVFEKLK SVLKIAKGAR ELCRALKALG YKIAVVSGGF QPLAEWLAGQ LGIDIAIANH       360
     LEIDEATQTL TGKLVPSYPI VDAAHKRTLL KSIAAENGIP LSQTMAVGDG ANDLLMLHAA       420
     GLGVAWRAKS KVQLEAPVRI NGESLVDVLY LLGMDNEDIA ELTSDVQ                     467
//

If you have problems or comments...

PBIL Back to PBIL home page