(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE323

PENCW_16.PE323       Location/Qualifiers
FT   CDS             join(739240..739863,739916..742921)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948864"
FT                   /orf_name="Pc20g03230"
FT                   /product="Pc20g03230 protein"
FT                   /protein_id="CAP85652.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001831D5C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ4"
FT                   /transl_table=1
FT                   /translation="MKWLPRFRPRKASSGDPKGNSAVAPSPPVGPEMIAPSTNSIPASS
FT                   LSEQATSPSVVDSSPFPTAVCAAQLQAGQAAASISPSAGSPPAPSTSAVQDIDIWTTAY
FT                   EVVENREPELMTDYASHLASIQGNPTTKNHISSSEFVEDVVTQLLEEREKKQWRLPLLG
FT                   NNVIVRKQAERLAKVLLWADPVVKRAVSTQPYAALAWSSVSILLPLLTGAATPDVAMLK
FT                   GFNSISDVQVYWAIFEETYLSSSHRQHYENLIEPLAKLYSYIIEYQARAICHLSKTQLS
FT                   RGWQNVAGEDDWAEKASEIEALSEARSSLISHDNETEIRERWGRQLREIQESSAILKEI
FT                   RQVLDETQRQTQGNYEDKAEKDLLHDLASDYEGYKDFNRLRVQGTCEWFFNDEKFCKWR
FT                   DSNTSGLLWLSAGPGCGKSILSRALIDERRLSLNVTTSTVCHFFFKDGYEDRMYSVNAL
FT                   CAVLHQLFSHDPSGALIKLALPAHKNYGKSLVRNFSELWNILLDCAKSPHAGEIVCIFD
FT                   ALDECEQQSRLQLISKLKDFYCQPQGSSALSSKLSFLITSRPYAEIERNFSGFSTTEYL
FT                   HFDGDKKSVAITREIDLVIDDHVSQIIGNFTANDQLEISKRLKTMENRTYLWLYVIFET
FT                   IKEDPSRHGKRSSVEKLLNNIPSKLSEAYEKILGRSRCQEETQHLLEIILAAARPLTLD
FT                   EANVALTLALAEEDFTSHSALENDLWPKNNFESIVKGLSGLFISVHDSKLFFIHQTARE
FT                   FLIDPSGRGTWEGRLSMSKSSRTISRTCFKFLMLPDLRASVKDADFWDDDDYDLNDPNH
FT                   VTLEQLPPFFCYAADHWPSHFLSQGATDIDQSLKDARTLCNRHQAWVWVTASGWTPGGR
FT                   LTLFHHMTDLSLASYFGLKQVVENILTEEHIDVNTEDESSTLALRSSRSALSAACLGGK
FT                   SDVVTLLLDKGANVNSYHKLHATALYTALVYGHQDIVPILLEKGADVNITGEHHGTALY
FT                   MASHLGNPDIVLSILERGADINYNHKWHGTALYRACRSGHPKVVKILLENGANVNIGDR
FT                   GYGSALLAASTHNCPDIVIDLLKKDADTDYNNQKYGTALRMASGHGWQNVVEVLLAHGA
FT                   DPNIRGTEYGSSPIQVASFFGHQGAVEELLKHGADVNFPDQQGNTALLAAARQGHREIV
FT                   SMLLRCGADVTVKGERYGTALNAATEAGHTEIIEMLAKRGAKV"
     MKWLPRFRPR KASSGDPKGN SAVAPSPPVG PEMIAPSTNS IPASSLSEQA TSPSVVDSSP        60
     FPTAVCAAQL QAGQAAASIS PSAGSPPAPS TSAVQDIDIW TTAYEVVENR EPELMTDYAS       120
     HLASIQGNPT TKNHISSSEF VEDVVTQLLE EREKKQWRLP LLGNNVIVRK QAERLAKVLL       180
     WADPVVKRAV STQPYAALAW SSVSILLPLL TGAATPDVAM LKGFNSISDV QVYWAIFEET       240
     YLSSSHRQHY ENLIEPLAKL YSYIIEYQAR AICHLSKTQL SRGWQNVAGE DDWAEKASEI       300
     EALSEARSSL ISHDNETEIR ERWGRQLREI QESSAILKEI RQVLDETQRQ TQGNYEDKAE       360
     KDLLHDLASD YEGYKDFNRL RVQGTCEWFF NDEKFCKWRD SNTSGLLWLS AGPGCGKSIL       420
     SRALIDERRL SLNVTTSTVC HFFFKDGYED RMYSVNALCA VLHQLFSHDP SGALIKLALP       480
     AHKNYGKSLV RNFSELWNIL LDCAKSPHAG EIVCIFDALD ECEQQSRLQL ISKLKDFYCQ       540
     PQGSSALSSK LSFLITSRPY AEIERNFSGF STTEYLHFDG DKKSVAITRE IDLVIDDHVS       600
     QIIGNFTAND QLEISKRLKT MENRTYLWLY VIFETIKEDP SRHGKRSSVE KLLNNIPSKL       660
     SEAYEKILGR SRCQEETQHL LEIILAAARP LTLDEANVAL TLALAEEDFT SHSALENDLW       720
     PKNNFESIVK GLSGLFISVH DSKLFFIHQT AREFLIDPSG RGTWEGRLSM SKSSRTISRT       780
     CFKFLMLPDL RASVKDADFW DDDDYDLNDP NHVTLEQLPP FFCYAADHWP SHFLSQGATD       840
     IDQSLKDART LCNRHQAWVW VTASGWTPGG RLTLFHHMTD LSLASYFGLK QVVENILTEE       900
     HIDVNTEDES STLALRSSRS ALSAACLGGK SDVVTLLLDK GANVNSYHKL HATALYTALV       960
     YGHQDIVPIL LEKGADVNIT GEHHGTALYM ASHLGNPDIV LSILERGADI NYNHKWHGTA      1020
     LYRACRSGHP KVVKILLENG ANVNIGDRGY GSALLAASTH NCPDIVIDLL KKDADTDYNN      1080
     QKYGTALRMA SGHGWQNVVE VLLAHGADPN IRGTEYGSSP IQVASFFGHQ GAVEELLKHG      1140
     ADVNFPDQQG NTALLAAARQ GHREIVSMLL RCGADVTVKG ERYGTALNAA TEAGHTEIIE      1200
     MLAKRGAKV                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page