(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE324

PENCW_16.PE324       Location/Qualifiers
FT   CDS             complement(743002..744297)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948865"
FT                   /orf_name="Pc20g03240"
FT                   /product="Pc20g03240 protein"
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring nitrogenous
FT                   groups"
FT                   /protein_id="CAP85653.1"
FT                   /db_xref="GO:0016769"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001831D5D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ5"
FT                   /transl_table=1
FT                   /translation="MTQSVLSRRAQDVVDAGSENPMWDVMKDTWHASTNPTGYVNVGVA
FT                   ENALMHDELLEFINKKLELPAKYLTYNDGGGGSSRLKAAIAAFLNHNLKPVIPLEPSHI
FT                   MATNGVSSAIEHVAWSFADPGEGILLGRPYYGMFIPDMSLRTGSSVVPVSFGELDPLSV
FT                   EGVDKYEEALLEFHRTTGKKVKALMLAHPHNPLGRCYSREVLVKLMRLCQKYQVHFISD
FT                   EIYALSVFENTVGEHPPPVKFESALSIDLTGIIDPRLVHVLWGMSKDFGANGIRLGVII
FT                   SQANRDIHMALTGPSLYSYASGITDHLTALILEDFDFTTRYIQQNQKLLSESYAYTANY
FT                   LKEHGIEYATGCNAAFFVWMNLGKKYRELHPEDECENVGERIMQRLLQKKVFLASGFLF
FT                   GSEKDGWFRIVFTQGHDYLSVALERINAALEE"
     MTQSVLSRRA QDVVDAGSEN PMWDVMKDTW HASTNPTGYV NVGVAENALM HDELLEFINK        60
     KLELPAKYLT YNDGGGGSSR LKAAIAAFLN HNLKPVIPLE PSHIMATNGV SSAIEHVAWS       120
     FADPGEGILL GRPYYGMFIP DMSLRTGSSV VPVSFGELDP LSVEGVDKYE EALLEFHRTT       180
     GKKVKALMLA HPHNPLGRCY SREVLVKLMR LCQKYQVHFI SDEIYALSVF ENTVGEHPPP       240
     VKFESALSID LTGIIDPRLV HVLWGMSKDF GANGIRLGVI ISQANRDIHM ALTGPSLYSY       300
     ASGITDHLTA LILEDFDFTT RYIQQNQKLL SESYAYTANY LKEHGIEYAT GCNAAFFVWM       360
     NLGKKYRELH PEDECENVGE RIMQRLLQKK VFLASGFLFG SEKDGWFRIV FTQGHDYLSV       420
     ALERINAALE E                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page