(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE327

PENCW_16.PE327       Location/Qualifiers
FT   CDS             join(complement(748914..748969),complement(748699..748855),
FT                   complement(747097..748638))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000195659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671926"
FT                   /orf_name="Pc20g03270"
FT                   /product="Pc20g03270 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85656.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI0001831D60"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ8"
FT                   /transl_table=1
FT                   /translation="MGRRKIEIKAIKDDRNRSVTFLKRKGGLFKKAHELAVLCSVDVAV
FT                   IIFGHNKKLYEYSSCDMHDALGRYQYFGPPHEHKGPEDFAGKRDDDDEEDEASPAPEDI
FT                   QAVQQNHPAIPPHLQSQPAFQHMNHAPSASPPIHHAMTRHGTPQPQGTSRPSSRNHIRR
FT                   VSSNLGPQQHGTPPPPPPPGPQNGGFTYMPNPSMYNPNVHAMNQQPRPAQFAHYGHPPG
FT                   QHQGTPPMHPHGLPQQMPPQHQGQQHFQHGHPVGMPPGPHQHVQQAYMQEHGRNSMPPG
FT                   FAPDHQERPASEHPQDDSVMKAEHSQSPPQIKSLSKSRSIFTPIDDRGSVLARHFGAGA
FT                   GSYESHNSHSLKVEAPQASIASKSMPVRAATEAPRAGSIASTPKIKPPSRTNSGPLPSK
FT                   RPQLKVQIPSETSDAGSATADSSHDSAVNKNSPPAKGNVENGPPGVVLPPPSPSAGAIL
FT                   SAGAQGPPNPFARPPPPVAATRNDSYGSNSGNPNNGNNSNNIETPISALPSRFVSDALL
FT                   PSPSSFFPEWGFGRSGPDSNMLPSPLTFPTPAVQSGPSFSREDEQDKKRKSPDSGSAGE
FT                   GAHKKPKT"
     MGRRKIEIKA IKDDRNRSVT FLKRKGGLFK KAHELAVLCS VDVAVIIFGH NKKLYEYSSC        60
     DMHDALGRYQ YFGPPHEHKG PEDFAGKRDD DDEEDEASPA PEDIQAVQQN HPAIPPHLQS       120
     QPAFQHMNHA PSASPPIHHA MTRHGTPQPQ GTSRPSSRNH IRRVSSNLGP QQHGTPPPPP       180
     PPGPQNGGFT YMPNPSMYNP NVHAMNQQPR PAQFAHYGHP PGQHQGTPPM HPHGLPQQMP       240
     PQHQGQQHFQ HGHPVGMPPG PHQHVQQAYM QEHGRNSMPP GFAPDHQERP ASEHPQDDSV       300
     MKAEHSQSPP QIKSLSKSRS IFTPIDDRGS VLARHFGAGA GSYESHNSHS LKVEAPQASI       360
     ASKSMPVRAA TEAPRAGSIA STPKIKPPSR TNSGPLPSKR PQLKVQIPSE TSDAGSATAD       420
     SSHDSAVNKN SPPAKGNVEN GPPGVVLPPP SPSAGAILSA GAQGPPNPFA RPPPPVAATR       480
     NDSYGSNSGN PNNGNNSNNI ETPISALPSR FVSDALLPSP SSFFPEWGFG RSGPDSNMLP       540
     SPLTFPTPAV QSGPSFSRED EQDKKRKSPD SGSAGEGAHK KPKT                        584
//

If you have problems or comments...

PBIL Back to PBIL home page