(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE328

PENCW_16.PE328       Location/Qualifiers
FT   CDS             join(750664..750853,750927..751084,751148..751241,
FT                   751295..751523,751577..753951,753995..754086)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195648" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948866"
FT                   /orf_name="Pc20g03280"
FT                   /product="Pc20g03280 protein"
FT                   /protein_id="CAP85657.1"
FT                   /db_xref="InterPro:IPR012965"
FT                   /db_xref="UniParc:UPI0001831D61"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ9"
FT                   /transl_table=1
FT                   /translation="MSFFSRVFRGKDSTATKKQVKPTAPVNTAPAKPKWTDAWQRTEVA
FT                   PEEVQDLVRGCVHELKARALDTPFLLLPFRPSSDPSAARTFIRNYFNQSFEKGSPVNGD
FT                   ALSQELRLTEPMVVCGVMKWCWSRLPGGVVTWEAYETFKMGEHDSDMARDAFSTFIPIG
FT                   GDSEARTNIILDFFDLLAAIAAHGKSNGLGGRKLSRYAGWWAFEHVDTGNGFEAAYKNW
FT                   AAAADATSHLFFAYLRSLSPDVPGGVSGISSLPISLQSLVEATEYPPETPTLLQMTTTK
FT                   VVMIVENVSPTPFSLLRRAKNFEYRDDDWHLQEFANYEDPVSALTDECLRVLTCISSTN
FT                   QSSVSSTKQSTSLRDASWSRFEDIGFGGSIESDPEDEAKETAPPVTAKSGSAAGLKSVP
FT                   QSGTGDLGRPTTPSWADFMSSGFADENNLKQHVGPLLLPPDKVLPPIASARGMSSQSHK
FT                   RSLDIEPALEPAELASINTLDMDDSFWWVWISSLSGDEPSARKAVFGRCALLETRIRDT
FT                   KWLILEEQVKGAAPEPEAGAQIVEKKRFFSFGSRKGKLGRRKSSAKKVPSSIEDSYKRP
FT                   NNLGTQSKTSIGPDQHKRIQEAAAALQRKHREQEAEAKENRAAPNNSRYSKTNSVMTLQ
FT                   PAIVNEASQAMKWTKNYDKGAFRAAYLSDNRAGTGHIEEPEETPEPISKDPEEKPTAPL
FT                   APLPTNTAKSAPPPLPKEAAAAVSTPLPPFPKEVPTKPVNVATPEEEKPITKPAVVEQP
FT                   TERRESMDEMGKKLKKKTGNSAFKSMFSAKKKPEQQQPPVKNGDSKEISNVAATRAALE
FT                   AKAKAAQESGPVKKKPLPTAAAVAVTPVATEPEKPSSPQPVQPTINEPVTNPTSPTPPS
FT                   ASLKENGENGAPPKTRRAVEYDALSRVGTNERDAADQEFSKFDQGPLTDQPAFVPADSP
FT                   VEVTPAAQKPELPQTPTNGNGVRPVSATSPESTEATQDRWKAIREAAAQRTAAAQAEKA
FT                   HEHDTEANTRTSQSERTDEGDTSGEEIAFPAIEARVARIKARVAELTGNAEDGPRR"
     MSFFSRVFRG KDSTATKKQV KPTAPVNTAP AKPKWTDAWQ RTEVAPEEVQ DLVRGCVHEL        60
     KARALDTPFL LLPFRPSSDP SAARTFIRNY FNQSFEKGSP VNGDALSQEL RLTEPMVVCG       120
     VMKWCWSRLP GGVVTWEAYE TFKMGEHDSD MARDAFSTFI PIGGDSEART NIILDFFDLL       180
     AAIAAHGKSN GLGGRKLSRY AGWWAFEHVD TGNGFEAAYK NWAAAADATS HLFFAYLRSL       240
     SPDVPGGVSG ISSLPISLQS LVEATEYPPE TPTLLQMTTT KVVMIVENVS PTPFSLLRRA       300
     KNFEYRDDDW HLQEFANYED PVSALTDECL RVLTCISSTN QSSVSSTKQS TSLRDASWSR       360
     FEDIGFGGSI ESDPEDEAKE TAPPVTAKSG SAAGLKSVPQ SGTGDLGRPT TPSWADFMSS       420
     GFADENNLKQ HVGPLLLPPD KVLPPIASAR GMSSQSHKRS LDIEPALEPA ELASINTLDM       480
     DDSFWWVWIS SLSGDEPSAR KAVFGRCALL ETRIRDTKWL ILEEQVKGAA PEPEAGAQIV       540
     EKKRFFSFGS RKGKLGRRKS SAKKVPSSIE DSYKRPNNLG TQSKTSIGPD QHKRIQEAAA       600
     ALQRKHREQE AEAKENRAAP NNSRYSKTNS VMTLQPAIVN EASQAMKWTK NYDKGAFRAA       660
     YLSDNRAGTG HIEEPEETPE PISKDPEEKP TAPLAPLPTN TAKSAPPPLP KEAAAAVSTP       720
     LPPFPKEVPT KPVNVATPEE EKPITKPAVV EQPTERRESM DEMGKKLKKK TGNSAFKSMF       780
     SAKKKPEQQQ PPVKNGDSKE ISNVAATRAA LEAKAKAAQE SGPVKKKPLP TAAAVAVTPV       840
     ATEPEKPSSP QPVQPTINEP VTNPTSPTPP SASLKENGEN GAPPKTRRAV EYDALSRVGT       900
     NERDAADQEF SKFDQGPLTD QPAFVPADSP VEVTPAAQKP ELPQTPTNGN GVRPVSATSP       960
     ESTEATQDRW KAIREAAAQR TAAAQAEKAH EHDTEANTRT SQSERTDEGD TSGEEIAFPA      1020
     IEARVARIKA RVAELTGNAE DGPRR                                            1045
//

If you have problems or comments...

PBIL Back to PBIL home page