(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE329

PENCW_16.PE329       Location/Qualifiers
FT   CDS             join(complement(755551..755628),complement(755199..755436),
FT                   complement(754698..755089))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948867"
FT                   /orf_name="Pc20g03290"
FT                   /product="Pc20g03290 protein"
FT                   /protein_id="CAP85658.1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI0001831D62"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFR0"
FT                   /transl_table=1
FT                   /translation="MTPKVLVVLTSHDKLGSTGNPTGWYLPEFAHPWEVLHEKVSLTIA
FT                   SPKGGEAPLDPASVKMFESDEASQKFLKEQKALWTNTHKLADVLPRAGEFDAIFYVGGH
FT                   GPMFDLTEDPTSLALIQTFAAANKPVAAVCHGPCVLLNATAPSGVPLISGVGVTGFSNA
FT                   EEDAVSLSAAMPFMLETELGRVSGGKYVKAAEPWGEMVVVGKAAGTGSTIITGQNPGSA
FT                   TGVGKEILKALGL"
     MTPKVLVVLT SHDKLGSTGN PTGWYLPEFA HPWEVLHEKV SLTIASPKGG EAPLDPASVK        60
     MFESDEASQK FLKEQKALWT NTHKLADVLP RAGEFDAIFY VGGHGPMFDL TEDPTSLALI       120
     QTFAAANKPV AAVCHGPCVL LNATAPSGVP LISGVGVTGF SNAEEDAVSL SAAMPFMLET       180
     ELGRVSGGKY VKAAEPWGEM VVVGKAAGTG STIITGQNPG SATGVGKEIL KALGL            235
//

If you have problems or comments...

PBIL Back to PBIL home page