(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE33

PENCW_16.PE33        Location/Qualifiers
FT   CDS             join(complement(79580..79851),complement(79037..79514))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187553" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977334"
FT                   /orf_name="Pc20g00330"
FT                   /product="Pc20g00330 protein"
FT                   /protein_id="CAP85362.1"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI00018319D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD0"
FT                   /transl_table=1
FT                   /translation="MIETPMTTPPGPELSPPSSPDGLKISESLAPPRELKAATTTDISF
FT                   DGLLKEPLLLKEDLKDGCGGQLWPAGMALAKYLLSRHAADLSDKTIVELGAGGGLVGLA
FT                   VARGCHLEQPIYITDQEPMFSLMKSNIQLNNLGPNATAAILNWGEPIPKQIPSKPNVII
FT                   AADCVYFEPAFPLLITTLQDLLGPNSVCYFCYKRRRRADMRFMKMAKKAFEMELVRDDP
FT                   GAEGYNRESIFIYTIRAKRLDQKSETR"
     MIETPMTTPP GPELSPPSSP DGLKISESLA PPRELKAATT TDISFDGLLK EPLLLKEDLK        60
     DGCGGQLWPA GMALAKYLLS RHAADLSDKT IVELGAGGGL VGLAVARGCH LEQPIYITDQ       120
     EPMFSLMKSN IQLNNLGPNA TAAILNWGEP IPKQIPSKPN VIIAADCVYF EPAFPLLITT       180
     LQDLLGPNSV CYFCYKRRRR ADMRFMKMAK KAFEMELVRD DPGAEGYNRE SIFIYTIRAK       240
     RLDQKSETR                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page