(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE330

PENCW_16.PE330       Location/Qualifiers
FT   CDS             join(complement(757060..757493),complement(756311..756458))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948868"
FT                   /orf_name="Pc20g03300"
FT                   /product="Putative uncharacterized protein Pc20g03300 "
FT                   /protein_id="CAP85659.1"
FT                   /db_xref="UniParc:UPI0001831D63"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFR1"
FT                   /transl_table=1
FT                   /translation="MAYNSDVEEYLRLHQLFQLSGEELNYHPGTSATQPPVHSTEWSLY
FT                   NPSISHASESLDPSWSMHTTIGHPTADNLYQSTMQSSSTSQHRGTEDGIQDHFSPDRTT
FT                   IQIQSSRSSPPTQLASPSNYHNVEVADVEATSTRHEPQQQEKKDGSPTSPVPEFPISSR
FT                   VPDSKAVSSMPRYPCRDENALVYMYVQQNG"
     MAYNSDVEEY LRLHQLFQLS GEELNYHPGT SATQPPVHST EWSLYNPSIS HASESLDPSW        60
     SMHTTIGHPT ADNLYQSTMQ SSSTSQHRGT EDGIQDHFSP DRTTIQIQSS RSSPPTQLAS       120
     PSNYHNVEVA DVEATSTRHE PQQQEKKDGS PTSPVPEFPI SSRVPDSKAV SSMPRYPCRD       180
     ENALVYMYVQ QNG                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page