(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE331

PENCW_16.PE331       Location/Qualifiers
FT   CDS             join(complement(761217..761223),complement(760890..761134),
FT                   complement(760748..760814),complement(760623..760694),
FT                   complement(760380..760569),complement(760211..760323),
FT                   complement(759272..760158))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195637" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824635"
FT                   /orf_name="Pc20g03310"
FT                   /product="Pc20g03310 protein"
FT                   /protein_id="CAP85660.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001831D64"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFR2"
FT                   /transl_table=1
FT                   /translation="MTYCTPYLLQLGLTKSKTSLVWIAGPLSGLIIQPLIGVIADRSRS
FT                   KWGRRRPFMVFGSLVVAFCLFVLGWTAEIVGLFVKDPEKAKNGTIALAVLSIYAVDFSI
FT                   NVVQACCRGLIVDTLPIPSQQAGSAWAGRMSAIGQLFAYVVGAIDTVSIFGTFLGDTQF
FT                   KQMTVIAALSLMLAVGVTSYSVKERVLISARDDGSAGAIQVLSQLFKTTFELPPRIQAI
FT                   CWAQFWAWIGWFPFLFYSTTWVGETYFRYEVPKDDMAKATDMLGEVGRVGSLSLTVFSF
FT                   ITVLSSVLLPFCIMQPDAKRTRFTARPPPKVAAILKAISAIRPDLQTAWLISHVMFAAT
FT                   MIFAPLAHSRAFATFLVAVCGIPWAISGWAPFAFMGVEINRLTMGGYYPTIPSSRSGVT
FT                   MITSASLRNSAADTELDVLRLNHHDPTDSDTDEEEQASNIPSTGELAGIYLGVLNVYTT
FT                   LPQFVGTFISWIVFSILEPGEEPANSNSDTQWMNLDKDRYNAISICLFIGAISALVAAE
FT                   ATRRLRYIL"
     MTYCTPYLLQ LGLTKSKTSL VWIAGPLSGL IIQPLIGVIA DRSRSKWGRR RPFMVFGSLV        60
     VAFCLFVLGW TAEIVGLFVK DPEKAKNGTI ALAVLSIYAV DFSINVVQAC CRGLIVDTLP       120
     IPSQQAGSAW AGRMSAIGQL FAYVVGAIDT VSIFGTFLGD TQFKQMTVIA ALSLMLAVGV       180
     TSYSVKERVL ISARDDGSAG AIQVLSQLFK TTFELPPRIQ AICWAQFWAW IGWFPFLFYS       240
     TTWVGETYFR YEVPKDDMAK ATDMLGEVGR VGSLSLTVFS FITVLSSVLL PFCIMQPDAK       300
     RTRFTARPPP KVAAILKAIS AIRPDLQTAW LISHVMFAAT MIFAPLAHSR AFATFLVAVC       360
     GIPWAISGWA PFAFMGVEIN RLTMGGYYPT IPSSRSGVTM ITSASLRNSA ADTELDVLRL       420
     NHHDPTDSDT DEEEQASNIP STGELAGIYL GVLNVYTTLP QFVGTFISWI VFSILEPGEE       480
     PANSNSDTQW MNLDKDRYNA ISICLFIGAI SALVAAEATR RLRYIL                      526
//

If you have problems or comments...

PBIL Back to PBIL home page