(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE332

PENCW_16.PE332       Location/Qualifiers
FT   CDS             join(761455..761601,761656..761952)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977855"
FT                   /orf_name="Pc20g03320"
FT                   /product="Putative uncharacterized protein Pc20g03320 "
FT                   /protein_id="CAP85661.1"
FT                   /db_xref="UniParc:UPI0001831D65"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG20"
FT                   /transl_table=1
FT                   /translation="MEGVPAHLAACGILIIHVLACTQLSSHEPKPESERAGGLASNRSK
FT                   LKTPGLGYVRDWERGRQVSNPFGELSRVLFSEPSGELAGAETVHGTLGVRCLLAVRILG
FT                   GGCVGCDGGADGCLYSCREASKGILRGKTLSQSKKKERKSALA"
     MEGVPAHLAA CGILIIHVLA CTQLSSHEPK PESERAGGLA SNRSKLKTPG LGYVRDWERG        60
     RQVSNPFGEL SRVLFSEPSG ELAGAETVHG TLGVRCLLAV RILGGGCVGC DGGADGCLYS       120
     CREASKGILR GKTLSQSKKK ERKSALA                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page