(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE333

PENCW_16.PE333       Location/Qualifiers
FT   CDS             join(complement(764445..764534),complement(764370..764390),
FT                   complement(763961..764311),complement(763694..763891),
FT                   complement(763555..763639),complement(762842..763498),
FT                   complement(762666..762778))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000046192" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128990"
FT                   /orf_name="Pc20g03330"
FT                   /product="Pc20g03330 protein"
FT                   /function="binding"
FT                   /function="glucose-6-phosphate dehydrogenase activity "
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85662.1"
FT                   /db_xref="GO:0004345"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniParc:UPI0001831D66"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG21"
FT                   /transl_table=1
FT                   /translation="MDMAFSTIELKDDTIIVVLGASGDLAKKKTFPALFGLFRNKFLPK
FT                   DIRIVGYARTKMDTDEYLKRVRSYIKVPTKEIEDQLDQFCKMCTYVSGQYDQDDSFINL
FT                   NKHLEEIENNRQSKEQNRVFYMALPPSVFTTVSDQLKRNCYPKSGLARIIVEKPFGKDL
FT                   QSSRDLQKALEPNWKEEEIFRIDHYLGKEMVKNILILRFGNEFFNATWNRRHIDNVQIT
FT                   FKEPFGTEGRGGYFDEFGIIRDVMQNHLLQVLTLLAMERPISFSSEDIRDEKVRVLRAM
FT                   DAIEPKNVIIGQYGRSLDGSKPGYLEDDTVPKESRCPTFCAMVAYIKNERWDGVPFILK
FT                   AGKALNEQKTEVRIQFKDVTSGIFKDIPRNELVIRVQPNESVYIKMNSKLPGLSMQTVV
FT                   TELDLTYRRRFSDLKIPEAYESLILDAFKGDHSNFVRDDELDASWRIFTPLLHYLDDNK
FT                   EIIPMEYPYGSRGPAVLDDFTASYGYKFSDAAGYQWPVTTSAPNRL"
     MDMAFSTIEL KDDTIIVVLG ASGDLAKKKT FPALFGLFRN KFLPKDIRIV GYARTKMDTD        60
     EYLKRVRSYI KVPTKEIEDQ LDQFCKMCTY VSGQYDQDDS FINLNKHLEE IENNRQSKEQ       120
     NRVFYMALPP SVFTTVSDQL KRNCYPKSGL ARIIVEKPFG KDLQSSRDLQ KALEPNWKEE       180
     EIFRIDHYLG KEMVKNILIL RFGNEFFNAT WNRRHIDNVQ ITFKEPFGTE GRGGYFDEFG       240
     IIRDVMQNHL LQVLTLLAME RPISFSSEDI RDEKVRVLRA MDAIEPKNVI IGQYGRSLDG       300
     SKPGYLEDDT VPKESRCPTF CAMVAYIKNE RWDGVPFILK AGKALNEQKT EVRIQFKDVT       360
     SGIFKDIPRN ELVIRVQPNE SVYIKMNSKL PGLSMQTVVT ELDLTYRRRF SDLKIPEAYE       420
     SLILDAFKGD HSNFVRDDEL DASWRIFTPL LHYLDDNKEI IPMEYPYGSR GPAVLDDFTA       480
     SYGYKFSDAA GYQWPVTTSA PNRL                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page