(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE334

PENCW_16.PE334       Location/Qualifiers
FT   CDS             join(766904..766928,767062..767071,767214..767267,
FT                   767332..767474,767572..767669)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948869"
FT                   /orf_name="Pc20g03340"
FT                   /product="Pc20g03340 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85663.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="UniParc:UPI0001831D67"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG22"
FT                   /transl_table=1
FT                   /translation="MPSEQGHRLYVKGRHLSFQRSKHALTQNTSLVKIEGVDDTKAAKF
FT                   YLGKKVAFVYRAKREVRGSNIRVIWGKVTRPHGNSGVVRAKFRNNLPPKSLGATVRVML
FT                   YPSNI"
     MPSEQGHRLY VKGRHLSFQR SKHALTQNTS LVKIEGVDDT KAAKFYLGKK VAFVYRAKRE        60
     VRGSNIRVIW GKVTRPHGNS GVVRAKFRNN LPPKSLGATV RVMLYPSNI                   109
//

If you have problems or comments...

PBIL Back to PBIL home page