(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE336

PENCW_16.PE336       Location/Qualifiers
FT   CDS             join(771693..771790,771850..772083,772143..773887,
FT                   773946..774676)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000031440" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977856"
FT                   /orf_name="Pc20g03360"
FT                   /product="Pc20g03360 protein"
FT                   /function="molybdenum ion binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP85665.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniParc:UPI0001831D69"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG24"
FT                   /transl_table=1
FT                   /translation="MDIGVRDGKVVGVRGRVSDRVNKGRLGPKGLHGWASINHADRLKH
FT                   PLIRRNGKLERASWDEAMSLIVDKAHEVQSRLSNHGIGFYTSGQLFLEEYYVLAMVGKA
FT                   GLNTLHMDGNTRLCTATAAASMRESFGSDGQPGSYSDIDYTDCLFLVGHNMAHTQTVLW
FT                   SRVLDRLQGPQPPKLIVVDPRRSDTAKQADVHLAPKNGTNVALLNGLQYLLFSNGWINE
FT                   DYVSKHVVGLEDLRTVVNRYTPDVVERITGVPVTQLHQAAEILGTTSSLLSTALQGVYQ
FT                   SNQATASACQINNINLLLGLIGKPGSGILQMNGQPTAQNNRETGCDGEYPGFRNFQNPT
FT                   HIQEIADIWNIEPVKVPHWNLPTHVENMLKYISDGSIKMFWISGTNPLVSLPHLQKVRE
FT                   LLTKPELFVVTQDIFLTETAAISDVVLPAAQWGEKTGCFTNADRTMHLSQKAVEPPGQS
FT                   KADMDIWLDFARRMDFQDKDGKPLIPFTSAEEVFNAWRKMSCGRPLDCTEMSYQKLAGG
FT                   SGIQWPCTSVYPQGKERLFDDAKFFTDTAYCESYGHDLETGAPFTKSQYEAMNPAGRAI
FT                   LKAAHYQLPLEETSEQYPLRLTTGRNVYQFHTRTKTGRSKRLQEAYPEPVIQVSIADAD
FT                   ALHLVDGEMVVVRSRRGSVELPVVIGDITEGHVFIPFHFGYFDATDDRARAANELTREQ
FT                   WDPVSKQPMFKSGAVRIEKCVQIEGGKTNHAKEKHTEAVRSVEKGKGMAEPADENGGHT
FT                   GNKEPVRRLELWMGALNEGLEILVEIYRDLVPRLVHDLEVQSGLEVMRRLTTEVLHQFK
FT                   PVIDRYHGSHQYGRTVAQYLQKAVFPAVEETNDPYEALAALQSLDLFLTYIEGHLTALS
FT                   PASQALWDSEFVNVISSAQGSIQRQKAWVNQHIKVKSPQTLLVPTVAAEDLYDSQSSMA
FT                   GRIRS"
     MDIGVRDGKV VGVRGRVSDR VNKGRLGPKG LHGWASINHA DRLKHPLIRR NGKLERASWD        60
     EAMSLIVDKA HEVQSRLSNH GIGFYTSGQL FLEEYYVLAM VGKAGLNTLH MDGNTRLCTA       120
     TAAASMRESF GSDGQPGSYS DIDYTDCLFL VGHNMAHTQT VLWSRVLDRL QGPQPPKLIV       180
     VDPRRSDTAK QADVHLAPKN GTNVALLNGL QYLLFSNGWI NEDYVSKHVV GLEDLRTVVN       240
     RYTPDVVERI TGVPVTQLHQ AAEILGTTSS LLSTALQGVY QSNQATASAC QINNINLLLG       300
     LIGKPGSGIL QMNGQPTAQN NRETGCDGEY PGFRNFQNPT HIQEIADIWN IEPVKVPHWN       360
     LPTHVENMLK YISDGSIKMF WISGTNPLVS LPHLQKVREL LTKPELFVVT QDIFLTETAA       420
     ISDVVLPAAQ WGEKTGCFTN ADRTMHLSQK AVEPPGQSKA DMDIWLDFAR RMDFQDKDGK       480
     PLIPFTSAEE VFNAWRKMSC GRPLDCTEMS YQKLAGGSGI QWPCTSVYPQ GKERLFDDAK       540
     FFTDTAYCES YGHDLETGAP FTKSQYEAMN PAGRAILKAA HYQLPLEETS EQYPLRLTTG       600
     RNVYQFHTRT KTGRSKRLQE AYPEPVIQVS IADADALHLV DGEMVVVRSR RGSVELPVVI       660
     GDITEGHVFI PFHFGYFDAT DDRARAANEL TREQWDPVSK QPMFKSGAVR IEKCVQIEGG       720
     KTNHAKEKHT EAVRSVEKGK GMAEPADENG GHTGNKEPVR RLELWMGALN EGLEILVEIY       780
     RDLVPRLVHD LEVQSGLEVM RRLTTEVLHQ FKPVIDRYHG SHQYGRTVAQ YLQKAVFPAV       840
     EETNDPYEAL AALQSLDLFL TYIEGHLTAL SPASQALWDS EFVNVISSAQ GSIQRQKAWV       900
     NQHIKVKSPQ TLLVPTVAAE DLYDSQSSMA GRIRS                                  935
//

If you have problems or comments...

PBIL Back to PBIL home page