(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE34

PENCW_16.PE34        Location/Qualifiers
FT   CDS             join(complement(81164..81179),complement(80801..81105),
FT                   complement(80608..80742))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000187564" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946683"
FT                   /orf_name="Pc20g00340"
FT                   /product="Pc20g00340 protein"
FT                   /protein_id="CAP85363.1"
FT                   /db_xref="InterPro:IPR013879"
FT                   /db_xref="UniParc:UPI00018319DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD1"
FT                   /transl_table=1
FT                   /translation="MTTLHYLPPVKPSAIALGTIFTHTASLGILAPVFGDTYHRAQAAN
FT                   SKEEFIKSKEAAGAAAAWGSSLAGSAVQTYGVAALINATGTLSYKGAAYLGTLIFFASS
FT                   APGIVSQVFSEKRPLDTIAVGAVSRVFETVGLSLFLTWWGTRTHPFD"
     MTTLHYLPPV KPSAIALGTI FTHTASLGIL APVFGDTYHR AQAANSKEEF IKSKEAAGAA        60
     AAWGSSLAGS AVQTYGVAAL INATGTLSYK GAAYLGTLIF FASSAPGIVS QVFSEKRPLD       120
     TIAVGAVSRV FETVGLSLFL TWWGTRTHPF D                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page