(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE340

PENCW_16.PE340       Location/Qualifiers
FT   CDS             join(complement(780883..781218),complement(780588..780797),
FT                   complement(780306..780495),complement(780107..780235),
FT                   complement(779515..779618))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948872"
FT                   /orf_name="Pc20g03400"
FT                   /product="Putative uncharacterized protein Pc20g03400 "
FT                   /protein_id="CAP85669.1"
FT                   /db_xref="UniParc:UPI0001831E4F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG27"
FT                   /transl_table=1
FT                   /translation="MTASPPSTSGTSTSTCNPYGSFLRGILAEISAMRGLRISRYYAEP
FT                   GRGYTPSDKSGRDCGADQLVALRSWVTIQCISFPRTRLAVERWIRRGALLRMLKVARVS
FT                   IDFTVEDVRRIMAKTANTATSRTSPARLYELRTSYSYIPLPAREHTQIAFAVHKAIDKA
FT                   LARMGLDEATHDYLGVDIDQIGIQQDLHLWRYPRPSRPSRQNDLLNKHIVHPSIGNVGE
FT                   NLGLQAELQSGGSYFAAVFEDTARLSIGELRVRQGTSFIATRKEGELFYPAATGKELLK
FT                   YLGWGSPCTRSKEYGPYDQVIGRVVASAKVTGTKEIETARL"
     MTASPPSTSG TSTSTCNPYG SFLRGILAEI SAMRGLRISR YYAEPGRGYT PSDKSGRDCG        60
     ADQLVALRSW VTIQCISFPR TRLAVERWIR RGALLRMLKV ARVSIDFTVE DVRRIMAKTA       120
     NTATSRTSPA RLYELRTSYS YIPLPAREHT QIAFAVHKAI DKALARMGLD EATHDYLGVD       180
     IDQIGIQQDL HLWRYPRPSR PSRQNDLLNK HIVHPSIGNV GENLGLQAEL QSGGSYFAAV       240
     FEDTARLSIG ELRVRQGTSF IATRKEGELF YPAATGKELL KYLGWGSPCT RSKEYGPYDQ       300
     VIGRVVASAK VTGTKEIETA RL                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page