(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE341

PENCW_16.PE341       Location/Qualifiers
FT   CDS             join(781313..781391,781523..781635,781721..781895,
FT                   781971..782179,782310..782360,782425..782524,
FT                   782647..782905,783080..783266)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977857"
FT                   /orf_name="Pc20g03410"
FT                   /product="Putative uncharacterized protein Pc20g03410 "
FT                   /protein_id="CAP85670.1"
FT                   /db_xref="UniParc:UPI0001831E50"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG28"
FT                   /transl_table=1
FT                   /translation="MTYFSKCQNSLQYKQSAAAFPARAWVATTSSSLPLCLRHAGRPCG
FT                   SVDLGLNCAFSSIKAPASSVCLTNVCTTDNAINVKEANAHGPGAIVLQAACEDLPPSLD
FT                   AHAALTIATCVVAVNFLSGSFSTTAALIRWSRTAENNRIAHLFLVPTFPSRLIRRGSGL
FT                   VHRTGGRMLEVFNDVEKQASPISIDGRRSVFELALGGTRRWPDPSRALRRRTLRATVFL
FT                   SSPFTTLGRIDELQGFSHGSGQLVRETHSTWWGDPFSVVITGDRRREWCARAVQGARWI
FT                   YPGWVRIVTTRALSWSLGRLQLVECRSSLAWPAASAHWSQPSKIESPKLARMRISVSAA
FT                   PMQRMSPISSSVDWVPLFIHAELACFLYLRLGLHNEGYQSLEDAGTYGCD"
     MTYFSKCQNS LQYKQSAAAF PARAWVATTS SSLPLCLRHA GRPCGSVDLG LNCAFSSIKA        60
     PASSVCLTNV CTTDNAINVK EANAHGPGAI VLQAACEDLP PSLDAHAALT IATCVVAVNF       120
     LSGSFSTTAA LIRWSRTAEN NRIAHLFLVP TFPSRLIRRG SGLVHRTGGR MLEVFNDVEK       180
     QASPISIDGR RSVFELALGG TRRWPDPSRA LRRRTLRATV FLSSPFTTLG RIDELQGFSH       240
     GSGQLVRETH STWWGDPFSV VITGDRRREW CARAVQGARW IYPGWVRIVT TRALSWSLGR       300
     LQLVECRSSL AWPAASAHWS QPSKIESPKL ARMRISVSAA PMQRMSPISS SVDWVPLFIH       360
     AELACFLYLR LGLHNEGYQS LEDAGTYGCD                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page