(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE342

PENCW_16.PE342       Location/Qualifiers
FT   CDS             join(complement(784270..784272),complement(783889..784197))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824636"
FT                   /orf_name="Pc20g03420"
FT                   /product="Putative uncharacterized protein Pc20g03420 "
FT                   /protein_id="CAP85671.1"
FT                   /db_xref="UniParc:UPI0001831E51"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG29"
FT                   /transl_table=1
FT                   /translation="MFNYILHCPHSIYTSTKDAYSQWVSSRSSLVVPGDLAVNFDSEWA
FT                   KLSVESSHYPRLRAAEESARSWYTGVVAFRQDVRDLVDDFELGVAVGPFLQSHLANFP"
     MFNYILHCPH SIYTSTKDAY SQWVSSRSSL VVPGDLAVNF DSEWAKLSVE SSHYPRLRAA        60
     EESARSWYTG VVAFRQDVRD LVDDFELGVA VGPFLQSHLA NFP                         103
//

If you have problems or comments...

PBIL Back to PBIL home page