(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE343

PENCW_16.PE343       Location/Qualifiers
FT   CDS             join(complement(787421..787651),complement(786956..787266),
FT                   complement(785678..786905))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160991" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948873"
FT                   /orf_name="Pc20g03430"
FT                   /product="Pc20g03430 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85672.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831E52"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG30"
FT                   /transl_table=1
FT                   /translation="MTSERQQPDAASSNTEIDHANVEKPLDTPEQENEAAQPSDAENVP
FT                   EQPTEGAPLDQAPSQAAKMSKNKIIVVMTALCTIISTALPTIAAQFGASESGFSWIASS
FT                   YLLANAACIPLWGKISDIWGRKSIIVLANVVFLVGSLVCALAHNMTTIIAGRAVQGVGG
FT                   GGILILANISVSDLFSLRDRPMYYGLFGATWAVAGALGPVIGGAFTTNVTWRWCFYLNL
FT                   PVGGVSLLILILFLHIESPKTPFWAGMRCIDWTGTFLIIGGTLMFLFGLEFGGVNYPWD
FT                   SPTVICLIVFGVFTWALAMFLEWKVAKFPIIPPRLFNEWYNVLILLVCFCHGFTFIAAT
FT                   YYLPLYFQTVLQASPILSGVYVLPLVLSLAVGSMITGAVMKKTGRFREMIIGGMTLMAL
FT                   GFGLFIDLKVYASWPRIIIYQLIAGLGIGPNFQAPLVAFQANIRPADMATATATFGFVR
FT                   QLSTSMSVVLGTVIYQNIMGQQSAKLIASLGPETAAAISSSFGGSSKSLIESLTPSQRD
FT                   VVLGAYTHALNRMWIFYTATACLGFVLALFIRRRELTRHHTVQKTGLAEQERARQELID
FT                   SQRKANSKPETEA"
     MTSERQQPDA ASSNTEIDHA NVEKPLDTPE QENEAAQPSD AENVPEQPTE GAPLDQAPSQ        60
     AAKMSKNKII VVMTALCTII STALPTIAAQ FGASESGFSW IASSYLLANA ACIPLWGKIS       120
     DIWGRKSIIV LANVVFLVGS LVCALAHNMT TIIAGRAVQG VGGGGILILA NISVSDLFSL       180
     RDRPMYYGLF GATWAVAGAL GPVIGGAFTT NVTWRWCFYL NLPVGGVSLL ILILFLHIES       240
     PKTPFWAGMR CIDWTGTFLI IGGTLMFLFG LEFGGVNYPW DSPTVICLIV FGVFTWALAM       300
     FLEWKVAKFP IIPPRLFNEW YNVLILLVCF CHGFTFIAAT YYLPLYFQTV LQASPILSGV       360
     YVLPLVLSLA VGSMITGAVM KKTGRFREMI IGGMTLMALG FGLFIDLKVY ASWPRIIIYQ       420
     LIAGLGIGPN FQAPLVAFQA NIRPADMATA TATFGFVRQL STSMSVVLGT VIYQNIMGQQ       480
     SAKLIASLGP ETAAAISSSF GGSSKSLIES LTPSQRDVVL GAYTHALNRM WIFYTATACL       540
     GFVLALFIRR RELTRHHTVQ KTGLAEQERA RQELIDSQRK ANSKPETEA                   589
//

If you have problems or comments...

PBIL Back to PBIL home page