(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE344

PENCW_16.PE344       Location/Qualifiers
FT   CDS             join(788016..788104,788308..788547,788606..788729,
FT                   788784..788885)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948874"
FT                   /orf_name="Pc20g03440"
FT                   /product="Putative uncharacterized protein Pc20g03440 "
FT                   /protein_id="CAP85673.1"
FT                   /db_xref="UniParc:UPI0001831E53"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG31"
FT                   /transl_table=1
FT                   /translation="MARAQYLGSYQPPLTSTLPTILSTQVAISPAWSSSSSREVRAAPL
FT                   VGFSSVVQLPLLRGLDSLAAGEVGGLLTAELLDCGSGGLQAKRGVAGELPQGLAYHHGT
FT                   ESTYHGGAHVRGAGEIGVETLCFALADKIYQYLPANEGLIGAKVDGNANVPQRANLHSS
FT                   REYAPFENKTFNGGAGSDANC"
     MARAQYLGSY QPPLTSTLPT ILSTQVAISP AWSSSSSREV RAAPLVGFSS VVQLPLLRGL        60
     DSLAAGEVGG LLTAELLDCG SGGLQAKRGV AGELPQGLAY HHGTESTYHG GAHVRGAGEI       120
     GVETLCFALA DKIYQYLPAN EGLIGAKVDG NANVPQRANL HSSREYAPFE NKTFNGGAGS       180
     DANC                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page