(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE345

PENCW_16.PE345       Location/Qualifiers
FT   CDS             789927..791600
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977858"
FT                   /orf_name="Pc20g03450"
FT                   /product="Pc20g03450 protein"
FT                   /protein_id="CAP85674.1"
FT                   /db_xref="UniParc:UPI0001831E54"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG32"
FT                   /transl_table=1
FT                   /translation="MVHIHDLPIELLHLILSFFVSPDELELLSGDQARKAKDGKAHQLD
FT                   DEEYDDDEPDGIETLYNTCLVSRKFREVAQPLLFRELFDDGLTGGLTPTVPFIRTIYRR
FT                   PDLGKHVHQISILPFPFVSGDRKHLSADDSEPFKGGIKDLGLGDQEEAWTSALEESDLG
FT                   ILAALLANKAPNLRGLHLPVRYFWIEPFIQLFHLNPQFLSNLESIWIESDDEMSGFDIA
FT                   FYEKFLTLPKVRFSTFEYGDLFDESFPSTWLPGTLETQELAFHHCHIDAGAIKKLMQAC
FT                   KKLRTFTYNNFSLDPNDRRIMRAGTVPEFDANQAHEAALVQKDTLELFHLEYAMELPDV
FT                   EHIEQLVSSHVKVGSFRDFSVLHTILIPHAALPVHPQLPSSLRRLHITDCNSSIRELTQ
FT                   NIAADCKNGLYPKLTHIKVFAIDITQPIKLPGQRIPEGKTPEQCFLALQDMFKGTKVNF
FT                   RILPYELPDFDDYDDLDLDYDEDLGFEEDFLEPGFEEHPPGADPGSGPIPPRLLDLLMQ
FT                   RAMMDPEFAHLRPDEGGDGDSWETDDDDDSWESDDSDSGN"
     MVHIHDLPIE LLHLILSFFV SPDELELLSG DQARKAKDGK AHQLDDEEYD DDEPDGIETL        60
     YNTCLVSRKF REVAQPLLFR ELFDDGLTGG LTPTVPFIRT IYRRPDLGKH VHQISILPFP       120
     FVSGDRKHLS ADDSEPFKGG IKDLGLGDQE EAWTSALEES DLGILAALLA NKAPNLRGLH       180
     LPVRYFWIEP FIQLFHLNPQ FLSNLESIWI ESDDEMSGFD IAFYEKFLTL PKVRFSTFEY       240
     GDLFDESFPS TWLPGTLETQ ELAFHHCHID AGAIKKLMQA CKKLRTFTYN NFSLDPNDRR       300
     IMRAGTVPEF DANQAHEAAL VQKDTLELFH LEYAMELPDV EHIEQLVSSH VKVGSFRDFS       360
     VLHTILIPHA ALPVHPQLPS SLRRLHITDC NSSIRELTQN IAADCKNGLY PKLTHIKVFA       420
     IDITQPIKLP GQRIPEGKTP EQCFLALQDM FKGTKVNFRI LPYELPDFDD YDDLDLDYDE       480
     DLGFEEDFLE PGFEEHPPGA DPGSGPIPPR LLDLLMQRAM MDPEFAHLRP DEGGDGDSWE       540
     TDDDDDSWES DDSDSGN                                                      557
//

If you have problems or comments...

PBIL Back to PBIL home page