(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE346

PENCW_16.PE346       Location/Qualifiers
FT   CDS             join(complement(793126..793166),complement(793042..793060),
FT                   complement(791981..792988))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948875"
FT                   /orf_name="Pc20g03460"
FT                   /product="Pc20g03460 protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAP85675.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0001831E55"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE4"
FT                   /transl_table=1
FT                   /translation="MAYNKSYNPDALPAHAEPEQVAQMLGNMNVSGQSHTSSHAPSHNQ
FT                   KPLPSRPPPQTSHSSGVPPRVPVSSAPPQHAYAAAPPRLDPQPHHSHSHSHSYGGRSSS
FT                   AHAPPPSQAPVHSQARPHPLHPSPPPQNYGFGPPPVHPQRNRPPPSSRPPQSPVPPPLT
FT                   APSDDPQQLFPLFRAANASHSGALTEGELGSALVNGDYTSFHPRTVRLMIRMFDRDGSG
FT                   TISFDEFVSLWRYLAAWRELFDRFDEDRSGRVSQPEFEKALVAFGYRLSGKFISVIFGV
FT                   FEGKAKQMSNAPKDARPPGMSFDLFVQACISLKRMTDVFKRYDEDRDGYITLSFEEALT
FT                   GKSCCSLCCCWGVSR"
     MAYNKSYNPD ALPAHAEPEQ VAQMLGNMNV SGQSHTSSHA PSHNQKPLPS RPPPQTSHSS        60
     GVPPRVPVSS APPQHAYAAA PPRLDPQPHH SHSHSHSYGG RSSSAHAPPP SQAPVHSQAR       120
     PHPLHPSPPP QNYGFGPPPV HPQRNRPPPS SRPPQSPVPP PLTAPSDDPQ QLFPLFRAAN       180
     ASHSGALTEG ELGSALVNGD YTSFHPRTVR LMIRMFDRDG SGTISFDEFV SLWRYLAAWR       240
     ELFDRFDEDR SGRVSQPEFE KALVAFGYRL SGKFISVIFG VFEGKAKQMS NAPKDARPPG       300
     MSFDLFVQAC ISLKRMTDVF KRYDEDRDGY ITLSFEEALT GKSCCSLCCC WGVSR            355
//

If you have problems or comments...

PBIL Back to PBIL home page