(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE347

PENCW_16.PE347       Location/Qualifiers
FT   CDS             join(793877..795150,795203..797138)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948876"
FT                   /orf_name="Pc20g03470"
FT                   /product="Pc20g03470 protein"
FT                   /protein_id="CAP85676.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001831E56"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE5"
FT                   /transl_table=1
FT                   /translation="MADPLSIASGVAGLLSLGVQVTKSLVDFYSAYKDQTPALAKITLN
FT                   LENLLGILQALDDARQHGQPQMDALVQEIDKAAVGCREIIEELSEECKKFQKDTALGLK
FT                   ARLQFVGRRATYPFRESTLKKLEEDIGEIRENLSLALNVLQLRNQTGLEYGISELKLLV
FT                   ERMNTIQISTTIRDWLRAPDATIDHNAACEKRHTSTGLWLVNGQKFQNWLVERNSFLWV
FT                   NGFAGCGKSVLCSTAIQYTVRERQHQPSVGIGFFYFSFNDESKRDCSGMLRALLLQLSA
FT                   QLQGAEGDIQELFKLYSSGTPPVKALLSSLRKTICRFNDTYILLDALDESPRGNKREGV
FT                   LDAVQTIRQWGLPTLHLLVTSRNEMDIRLTLEPPSSQDISMKNSDTDTDIQNFISYQLR
FT                   NDSKLRQWKSRHEEIQEKLTSKAQGVFRYVECQLLALKRARIRNHIDGCLRSLPRDLDE
FT                   TYERMLCSIDEQDAPEARLALTLLCVSDRPLTVEELIGALAIDVSKWQLDREGRSFSQD
FT                   HLLDICLGLIELAVVENEYSGEVSTIARIAHFSVQEYLKSDRISQQGAAKFAVQEELAE
FT                   TEMARVCLVYLLDPTLSDVESNEAMLEMFPLADFAAMEWSYFYKNSGKGKSDIKPLVLR
FT                   LFMDQPESFVTWVRVHDIDIGSPPMDLKRENIPPPLYYAIFLRLEFVFTAIIASFTEKI
FT                   TIDATLNTQEVVHEDVAQTMLDCRVGVNAQGGYYGNALQAASCGLFGDSVEEEDRQWEA
FT                   VEKMMQTLLDHGADVNAQGGIYGNALQAASYAGRERAVQTLLDHGADVNAYGGVYQTAL
FT                   QAASNPGHEALVRILLDRGADVNAREGTDASALEVASYYGHEKVVQILLDRGANINRDD
FT                   EYANALVFASYGGREKVVQMLLDRGSDVYVQEDLCKALEAASREGKEQVVQILLDRGAD
FT                   IDAQADGEYGNALQAASYAGQDKVVRMLLDRGADINTQGGDYGNALQAASWDGQEKVVQ
FT                   ILLDRGADVNAQGGGKYGNALQVASYMGHEKVVQILLHHGADVSAEGGENGNALRAALQ
FT                   EGHEKLVQILLDNGAKPEPIV"
     MADPLSIASG VAGLLSLGVQ VTKSLVDFYS AYKDQTPALA KITLNLENLL GILQALDDAR        60
     QHGQPQMDAL VQEIDKAAVG CREIIEELSE ECKKFQKDTA LGLKARLQFV GRRATYPFRE       120
     STLKKLEEDI GEIRENLSLA LNVLQLRNQT GLEYGISELK LLVERMNTIQ ISTTIRDWLR       180
     APDATIDHNA ACEKRHTSTG LWLVNGQKFQ NWLVERNSFL WVNGFAGCGK SVLCSTAIQY       240
     TVRERQHQPS VGIGFFYFSF NDESKRDCSG MLRALLLQLS AQLQGAEGDI QELFKLYSSG       300
     TPPVKALLSS LRKTICRFND TYILLDALDE SPRGNKREGV LDAVQTIRQW GLPTLHLLVT       360
     SRNEMDIRLT LEPPSSQDIS MKNSDTDTDI QNFISYQLRN DSKLRQWKSR HEEIQEKLTS       420
     KAQGVFRYVE CQLLALKRAR IRNHIDGCLR SLPRDLDETY ERMLCSIDEQ DAPEARLALT       480
     LLCVSDRPLT VEELIGALAI DVSKWQLDRE GRSFSQDHLL DICLGLIELA VVENEYSGEV       540
     STIARIAHFS VQEYLKSDRI SQQGAAKFAV QEELAETEMA RVCLVYLLDP TLSDVESNEA       600
     MLEMFPLADF AAMEWSYFYK NSGKGKSDIK PLVLRLFMDQ PESFVTWVRV HDIDIGSPPM       660
     DLKRENIPPP LYYAIFLRLE FVFTAIIASF TEKITIDATL NTQEVVHEDV AQTMLDCRVG       720
     VNAQGGYYGN ALQAASCGLF GDSVEEEDRQ WEAVEKMMQT LLDHGADVNA QGGIYGNALQ       780
     AASYAGRERA VQTLLDHGAD VNAYGGVYQT ALQAASNPGH EALVRILLDR GADVNAREGT       840
     DASALEVASY YGHEKVVQIL LDRGANINRD DEYANALVFA SYGGREKVVQ MLLDRGSDVY       900
     VQEDLCKALE AASREGKEQV VQILLDRGAD IDAQADGEYG NALQAASYAG QDKVVRMLLD       960
     RGADINTQGG DYGNALQAAS WDGQEKVVQI LLDRGADVNA QGGGKYGNAL QVASYMGHEK      1020
     VVQILLHHGA DVSAEGGENG NALRAALQEG HEKLVQILLD NGAKPEPIV                  1069
//

If you have problems or comments...

PBIL Back to PBIL home page