(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE348

PENCW_16.PE348       Location/Qualifiers
FT   CDS             join(complement(797572..798452),complement(797383..797518))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178410" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948877"
FT                   /orf_name="Pc20g03480"
FT                   /product="Pc20g03480 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85677.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831E57"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE6"
FT                   /transl_table=1
FT                   /translation="MAGLLRLLKMQYTPPIDPKNVSFAGKIVILTGATSGLGFEAAIKI
FT                   LNLGVESLIIGSRSVEKGNKAKADLEKTTNRRNVVKVWELEMNSFQSVKGFAERVNRDL
FT                   DRVDIALLNAGLWNREYNQSPEGWEETLQVNTLSTSMLALLLLPKLKKSSYAENPAHLT
FT                   VVSSQQFVRVKPESVRTDDALLAHVNDPENFKGPKQYGISKLLLEYMMKHIANMVRDDD
FT                   GTHTLIVNTVSPGLCISALGRQYTHWWEKCCVWVLHRLFARSTEQGSRSLVSATLLGIE
FT                   SQGKCWRSEGYLDESAALTTGLEGEELQEKAWEEIISVLEVQAPEVSLISRGLYQGV"
     MAGLLRLLKM QYTPPIDPKN VSFAGKIVIL TGATSGLGFE AAIKILNLGV ESLIIGSRSV        60
     EKGNKAKADL EKTTNRRNVV KVWELEMNSF QSVKGFAERV NRDLDRVDIA LLNAGLWNRE       120
     YNQSPEGWEE TLQVNTLSTS MLALLLLPKL KKSSYAENPA HLTVVSSQQF VRVKPESVRT       180
     DDALLAHVND PENFKGPKQY GISKLLLEYM MKHIANMVRD DDGTHTLIVN TVSPGLCISA       240
     LGRQYTHWWE KCCVWVLHRL FARSTEQGSR SLVSATLLGI ESQGKCWRSE GYLDESAALT       300
     TGLEGEELQE KAWEEIISVL EVQAPEVSLI SRGLYQGV                               338
//

If you have problems or comments...

PBIL Back to PBIL home page