(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE349

PENCW_16.PE349       Location/Qualifiers
FT   CDS             complement(798923..801571)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948878"
FT                   /orf_name="Pc20g03490"
FT                   /product="Pc20g03490 protein"
FT                   /protein_id="CAP85678.1"
FT                   /db_xref="InterPro:IPR021840"
FT                   /db_xref="UniParc:UPI0001831E58"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE7"
FT                   /transl_table=1
FT                   /translation="MSIKIPSLSKLINLSCKRGDTPSQLQQIEPDIPGWQPSYLRRRVL
FT                   IIFVITFCGVIAALEALNHVSQVRNGLASSDESRHYLWTYGPTAIFTIIATLWSRVEFQ
FT                   VKQRAPWKSMAEKPGEAGESVLLDYLSEMQVISMAKAIRNRHFDVAAGIACSMLLRLLV
FT                   IFSTALFSLKKAQIHQSSATGQAIVDGNRIVMAQVSLRVIEVCLILGILLAVAMIFLGP
FT                   RTTIAPWNPTSILSVATIMAKSNEICRSLRGRGASPLDALHHSLKERRYYSQHTPKGFL
FT                   IETEGVDTRKFDTQENHILPWAPFPGLIARSVIFGAVALLIAALEIALRVSQKNDGLTN
FT                   VSSNVHQHCLFTIISSLVMLSIGLLFERVDFNTRTLAPYAQLKRPTGALFEESMAVNYL
FT                   DSIPTTNIIRSIRARHFAVLATTSATLITSFLVITASGLYSAMEVPYQISVNFTQESTF
FT                   FRANSADAGQIPSMAVAKHILRKNMTFPRWTYDELAFPKLSMDMPLSNNERESLFVDIR
FT                   TPALRAAPACYFQTGSELRWNFTKVSYGDEPTYQLRVLAPNMPCSLAYQDMGSTSLTPS
FT                   LAVLNSQGLFGQSSRLPCGNIYNTKPATLYIWGNIQNDSAENISAMTCVEAAETVDTLT
FT                   RFYLPGFDIIDEHPPIPDESSTRSAPDIDIPWISWNNFNTKDATAKRSNLDAFFTALIM
FT                   GKYAISAEHLLDPDSSDMVIKAINHQDRILKAQAFNTYFRSAADGTLDHAPLPGNITMS
FT                   NRLRLLQDAASTRILQALLTSILVLGVVGSIVMNTDHILPKNPSSIGAVGSLLADSNLL
FT                   ARYEKGMGDPNEQSLGPASFSRCRFYLGFQGNASHQEIRGSCRKTTVVRSTVYTIRSEV
FT                   VRRCWATGRCG"
     MSIKIPSLSK LINLSCKRGD TPSQLQQIEP DIPGWQPSYL RRRVLIIFVI TFCGVIAALE        60
     ALNHVSQVRN GLASSDESRH YLWTYGPTAI FTIIATLWSR VEFQVKQRAP WKSMAEKPGE       120
     AGESVLLDYL SEMQVISMAK AIRNRHFDVA AGIACSMLLR LLVIFSTALF SLKKAQIHQS       180
     SATGQAIVDG NRIVMAQVSL RVIEVCLILG ILLAVAMIFL GPRTTIAPWN PTSILSVATI       240
     MAKSNEICRS LRGRGASPLD ALHHSLKERR YYSQHTPKGF LIETEGVDTR KFDTQENHIL       300
     PWAPFPGLIA RSVIFGAVAL LIAALEIALR VSQKNDGLTN VSSNVHQHCL FTIISSLVML       360
     SIGLLFERVD FNTRTLAPYA QLKRPTGALF EESMAVNYLD SIPTTNIIRS IRARHFAVLA       420
     TTSATLITSF LVITASGLYS AMEVPYQISV NFTQESTFFR ANSADAGQIP SMAVAKHILR       480
     KNMTFPRWTY DELAFPKLSM DMPLSNNERE SLFVDIRTPA LRAAPACYFQ TGSELRWNFT       540
     KVSYGDEPTY QLRVLAPNMP CSLAYQDMGS TSLTPSLAVL NSQGLFGQSS RLPCGNIYNT       600
     KPATLYIWGN IQNDSAENIS AMTCVEAAET VDTLTRFYLP GFDIIDEHPP IPDESSTRSA       660
     PDIDIPWISW NNFNTKDATA KRSNLDAFFT ALIMGKYAIS AEHLLDPDSS DMVIKAINHQ       720
     DRILKAQAFN TYFRSAADGT LDHAPLPGNI TMSNRLRLLQ DAASTRILQA LLTSILVLGV       780
     VGSIVMNTDH ILPKNPSSIG AVGSLLADSN LLARYEKGMG DPNEQSLGPA SFSRCRFYLG       840
     FQGNASHQEI RGSCRKTTVV RSTVYTIRSE VVRRCWATGR CG                          882
//

If you have problems or comments...

PBIL Back to PBIL home page