(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE35

PENCW_16.PE35        Location/Qualifiers
FT   CDS             join(complement(82771..82830),complement(82187..82695),
FT                   complement(82109..82133))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187575" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977335"
FT                   /orf_name="Pc20g00350"
FT                   /product="Pc20g00350 protein"
FT                   /protein_id="CAP85364.1"
FT                   /db_xref="InterPro:IPR016813"
FT                   /db_xref="UniParc:UPI00018319DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD2"
FT                   /transl_table=1
FT                   /translation="MARGIVNAAKSASNAISINQKYSVQSTGVWERIRRLLAIAPERST
FT                   GVPLNAQYRLPTPGSVPPLAYDDPVTLPAGDIADNPYWKRDVRRSYPQLSTVRQADAVG
FT                   LLTVGSQAAPKEDVLKIGQAGEQQLVAVKEQGEERGLAALFEQDKKSVQGVLGANGLPP
FT                   NPCNINAAPKPSQSKYELGTENGYPEKYTCRTFV"
     MARGIVNAAK SASNAISINQ KYSVQSTGVW ERIRRLLAIA PERSTGVPLN AQYRLPTPGS        60
     VPPLAYDDPV TLPAGDIADN PYWKRDVRRS YPQLSTVRQA DAVGLLTVGS QAAPKEDVLK       120
     IGQAGEQQLV AVKEQGEERG LAALFEQDKK SVQGVLGANG LPPNPCNINA APKPSQSKYE       180
     LGTENGYPEK YTCRTFV                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page